Novus Biologicals products are now on bio-techne.com

ATG7 Antibody (3X1W4)

Images

 
Western Blot: ATG7 Antibody (3X1W4) [NBP3-15808] - Analysis of extracts of various cell lines, using ATG7 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunohistochemistry-Paraffin: ATG7 Antibody (3X1W4) [NBP3-15808] - Rat spleen using ATG7 antibody (NBP3-15808) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before ...read more
Immunohistochemistry-Paraffin: ATG7 Antibody (3X1W4) [NBP3-15808] - Human esophageal cancer using ATG7 antibody (NBP3-15808) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH ...read more
Genetic Strategies: Western Blot: ATG7 Antibody (3X1W4) [NBP3-15808] - Analysis of extracts from wild type(WT) and HNRNPF knockout (KD) Human cells, using HNRNPF antibody (1) at dilution. Secondary antibody: HRP ...read more
Immunohistochemistry: ATG7 Antibody (3X1W4) [ATG7] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KD Validated] ATG7 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen ...read more
Immunohistochemistry: ATG7 Antibody (3X1W4) [ATG7] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using [KD Validated] ATG7 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure ...read more
Immunohistochemistry: ATG7 Antibody (3X1W4) [ATG7] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using [KD Validated] ATG7 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen ...read more
Immunohistochemistry: ATG7 Antibody (3X1W4) [ATG7] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KD Validated] ATG7 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen ...read more
Immunohistochemistry: ATG7 Antibody (3X1W4) [ATG7] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KD Validated] ATG7 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen ...read more
Western Blot: ATG7 Antibody (3X1W4) [ATG7] - Western blot analysis of various lysates using [KD Validated] ATG7 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IP
Clone
3X1W4
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

ATG7 Antibody (3X1W4) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atg7(Apg7) (O95352). MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
ATG7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:50 -1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ATG7 Antibody (3X1W4)

  • APG7 autophagy 7-like (S. cerevisiae)
  • APG7
  • APG7L
  • APG7-LIKE
  • ATG12-activating enzyme E1 ATG7
  • ATG7 autophagy related 7 homolog (S. cerevisiae)
  • ATG7
  • Autophagy-related protein 7
  • DKFZp434N0735
  • GSA7
  • hAGP7
  • ubiquitin activating enzyme E1-like protein
  • Ubiquitin-activating enzyme E1-like protein
  • ubiquitin-like modifier-activating enzyme ATG7

Background

FUNCTION: Functions as an E1 enzyme essential for multisubstrates such as GABARAPL1 and ATG12. Forms intermediate conjugates with GABARAPL1 (GABARAPL2, GABARAP or MAP1ALC3). Formation of the final GABARAPL1-PE conjugate is essential for autophagy. SUBUNIT: Homodimer (By similarity). Interacts with ATG3 and ATG12. The complex, composed of ATG3 and ATG7, plays a role in the conjugation of ATG12 to ATG5. SUBCELLULAR LOCATION: Cytoplasm (Probable). ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Widely expressed, especially in kidney, liver, lymph nodes and bone marrow. DOMAIN: The C-terminal part of the protein is essential for the dimerization and interaction with ATG3 and ATG12. SIMILARITY: Belongs to the ATG7 family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NB500-249
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
NBP2-82090
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-15501
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-55202
Species: Hu
Applications: IHC, IHC-P, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP2-01083
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-41217
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP3-15808
Species: Hu, Mu, Rt
Applications: WB, IHC, IP

Publications for ATG7 Antibody (NBP3-15808) (0)

There are no publications for ATG7 Antibody (NBP3-15808).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG7 Antibody (NBP3-15808) (0)

There are no reviews for ATG7 Antibody (NBP3-15808). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATG7 Antibody (NBP3-15808) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATG7 Products

Research Areas for ATG7 Antibody (NBP3-15808)

Find related products by research area.

Blogs on ATG7. Showing 1-10 of 13 blog posts - Show all blog posts.

Liver ASK1 activates autophagy to protect against hepatic fat accumulation, non-alcoholic steatohepatitis and fibrosis
By Jamshed Arslan, Pharm. D., PhD. The most common chronic liver disorder worldwide is non-alcoholic fatty liver disease (NAFLD). This obesity-linked disorder can manifest as hepatic fat accumulation (steatosis) wit...  Read full blog post.


  Read full blog post.


  Read full blog post.


  Read full blog post.

Animal Models to Study Autophagy
By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the...  Read full blog post.

Monitoring Autophagy in Neurons
By Christina Towers, PhD. Autophagy is a critical cellular process used by most cells in the body to recycle nutrients and prevent harmful buildup of damaged proteins. It is particularly important in the brain, where ...  Read full blog post.

Autophagy independent roles of the core ATG proteins
By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation.  It is critical for removal of dam...  Read full blog post.

Nuclear LC3: Why is it there and what is it doing?
By Christina Towers, PhD. Cells use the complex process of autophagy to degrade and recycle cytoplasmic material.  There are over 20 proteins that have been implicated in this process and appropriately named core ...  Read full blog post.

From Then ‘till Now: The History of Autophagy and Cancer Research
By Christina Towers, PhD. The fundamental process that cells use to degrade damaged cytoplasmic material and recycle nutrients is called autophagy.  This term was first coined by the Belgium biochemist Christian de...  Read full blog post.

ATG4B - a cysteine protease involved in autophagosome elongation
Autophagy can be broken down into 4 main stages: phagophore nucleation, autophagosome elongation, autophagosome docking and fusion with a lysosome, and vesicle breakdown and degradation. ATG4B is one of four ATG4 homologs (ATG4A, ATG4B, ATG4C, and ...  Read full blog post.

Showing 1-10 of 13 blog posts - Show all blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATG7 Antibody (3X1W4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG7