![Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85333] - Staining in human kidney and pancreas tissues using anti-APEH antibody. Corresponding APEH RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/APEH-Antibody-Immunohistochemistry-Paraffin-NBP1-85333-img0010.jpg "Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85333] - Staining in human kidney and pancreas tissues using anti-APEH antibody. Corresponding APEH RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | APEH |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC reported in scientific literature (PMID: 24554718). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-85333 | Applications | Species |
|---|---|---|
| Santhoshkumar P, Xie L, Raju M et al. Lens Crystallin Modifications and Cataract in Transgenic Mice Overexpressing Acylpeptide Hydrolase. J Biol Chem 2014-03-28 [PMID: 24554718] (IF/IHC, Mouse) | IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for APEH Antibody (NBP1-85333)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | APEH |
![Western Blot: APEH Antibody [NBP1-85333] - Analysis using Anti-APEH antibody NBP1-85333 (A) shows similar pattern to independent antibody NBP1-85332 (B).](http://images.novusbio.com/fullsize/APEH-Antibody-Western-Blot-NBP1-85333-img0011.jpg "Western Blot: APEH Antibody [NBP1-85333] - Analysis using Anti-APEH antibody NBP1-85333 (A) shows similar pattern to independent antibody NBP1-85332 (B).")
![Immunocytochemistry/Immunofluorescence: APEH Antibody [NBP1-85333] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/fullsize/APEH-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85333-img0006.jpg "Immunocytochemistry/Immunofluorescence: APEH Antibody [NBP1-85333] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.")
![Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85333] - Staining of human kidney.](http://images.novusbio.com/fullsize/APEH-Antibody-Immunohistochemistry-Paraffin-NBP1-85333-img0014.jpg "Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85333] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85333] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/APEH-Antibody-Immunohistochemistry-Paraffin-NBP1-85333-img0007.jpg "Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85333] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85333] - Staining of human colon.](http://images.novusbio.com/fullsize/APEH-Antibody-Immunohistochemistry-Paraffin-NBP1-85333-img0012.jpg "Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85333] - Staining of human colon.")
![Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85333] - Staining of human pancreas.](http://images.novusbio.com/fullsize/APEH-Antibody-Immunohistochemistry-Paraffin-NBP1-85333-img0013.jpg "Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85333] - Staining of human pancreas.")
![Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85333] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/APEH-Antibody-Immunohistochemistry-Paraffin-NBP1-85333-img0015.jpg "Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85333] - Staining of human cerebral cortex.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot ATF2 [p Thr69] Antibody](https://images.novusbio.com/images/ATF2-[p-Thr69]-Antibody-Western-Blot-NB100-81798-img0004.jpg)
![Immunohistochemistry-Paraffin ATF2 [p Thr69] Antibody](https://images.novusbio.com/images/ATF2-[p-Thr69]-Antibody-Immunohistochemistry-NB100-81798-img0003.jpg)
![Western Blot ATF2 [p Thr69] Antibody](https://images.novusbio.com/images/ATF2-[p-Thr69]-Antibody-Western-Blot-NB100-81798-img0001.jpg)
![Bioactivity GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212GD_2846.jpg)
![SDS-PAGE GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212-GD_62.jpg)
![SEC-MALS GDNF [Unconjugated]](https://images.novusbio.com/images/212-gd_recombinant-human-gdnf-protein-sec-mals-25202393740..jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")