![Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Analysis in human cerebral cortex and pancreas tissues. Corresponding ALDOC RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Aldolase-C-Antibody-Immunohistochemistry-Paraffin-NBP1-90954-img0015.jpg "Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Analysis in human cerebral cortex and pancreas tissues. Corresponding ALDOC RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVI |
| Marker | pan-Astrocyte Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ALDOC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-90954 | Applications | Species |
|---|---|---|
| Fack F, Espedal H, Keunen O et al. Bevacizumab treatment induces metabolic adaptation toward anaerobic metabolism in glioblastomas. Acta Neuropathol 2015-01-01 [PMID: 25322816] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Aldolase C Antibody (NBP1-90954)Find related products by research area.
|
|
RNA-binding protein Staufen1 conspires with Atxn2 in stress granules to cause neurodegeneration by dysregulating RNA metabolism By Jamshed Arslan Pharm.D. Spinocerebellar ataxia type 2 (SCA2) is a movement disorder characterized by neurodegeneration. The cause of this autosomal dominant disease is a mutation in the RNA processing gene Atxn2,... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ALDOC |
![Western Blot: Aldolase C Antibody [NBP1-90954] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Aldolase-C-Antibody-Western-Blot-NBP1-90954-img0008.jpg "Western Blot: Aldolase C Antibody [NBP1-90954] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunocytochemistry/Immunofluorescence: Aldolase C Antibody [NBP1-90954] - Staining of human cell line A-431 shows localization to nucleus, nucleoli fibrillar center & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Aldolase-C-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90954-img0009.jpg "Immunocytochemistry/Immunofluorescence: Aldolase C Antibody [NBP1-90954] - Staining of human cell line A-431 shows localization to nucleus, nucleoli fibrillar center & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human cerebral cortex shows strong cytoplasmic positivity in a subset of glial cells.](http://images.novusbio.com/fullsize/Aldolase-C-Antibody-Immunohistochemistry-Paraffin-NBP1-90954-img0018.jpg "Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human cerebral cortex shows strong cytoplasmic positivity in a subset of glial cells.")
![Western Blot: Aldolase C Antibody [NBP1-90954] - Analysis in human cerebral cortex tissue.](http://images.novusbio.com/fullsize/Aldolase-C-Antibody-Western-Blot-NBP1-90954-img0007.jpg "Western Blot: Aldolase C Antibody [NBP1-90954] - Analysis in human cerebral cortex tissue.")
![Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Aldolase-C-Antibody-Immunohistochemistry-Paraffin-NBP1-90954-img0016.jpg "Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/Aldolase-C-Antibody-Immunohistochemistry-Paraffin-NBP1-90954-img0017.jpg "Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/Aldolase-C-Antibody-Immunohistochemistry-Paraffin-NBP1-90954-img0019.jpg "Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")