![Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Analysis in human bone marrow and skeletal muscle tissues using NBP2-62698 antibody. Corresponding ADORA2A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Adenosine-A2aR-Antibody-Immunohistochemistry-Paraffin-NBP2-62698-img0005.jpg "Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Analysis in human bone marrow and skeletal muscle tissues using NBP2-62698 antibody. Corresponding ADORA2A RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADORA2A |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Adenosine A2aR Antibody (NBP2-62698)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ADORA2A |
![Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Adenosine-A2aR-Antibody-Immunohistochemistry-Paraffin-NBP2-62698-img0009.jpg "Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human caudate shows strong membranous positivity.](http://images.novusbio.com/fullsize/Adenosine-A2aR-Antibody-Immunohistochemistry-Paraffin-NBP2-62698-img0006.jpg "Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human caudate shows strong membranous positivity.")
![Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.](http://images.novusbio.com/fullsize/Adenosine-A2aR-Antibody-Immunohistochemistry-Paraffin-NBP2-62698-img0007.jpg "Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.")
![Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human duodenum shows strong cytoplasmic positivity in enteroendocrine cells.](http://images.novusbio.com/fullsize/Adenosine-A2aR-Antibody-Immunohistochemistry-Paraffin-NBP2-62698-img0008.jpg "Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human duodenum shows strong cytoplasmic positivity in enteroendocrine cells.")
![Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Adenosine-A2aR-Antibody-Immunohistochemistry-Paraffin-NBP2-62698-img0010.jpg "Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")