Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (2D5) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
ACVR1 (AAH33867, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF |
Specificity |
Reacts with activin A receptor, type I. |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
ACVR1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This antibody is reactive against recombinant protein in WB and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (2D5)
Background
Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA, BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Block, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Block, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (H00000090-M07) (0)
There are no publications for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (H00000090-M07).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (H00000090-M07) (0)
There are no reviews for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (H00000090-M07).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (H00000090-M07) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Activin RIA/ALK-2/Activin Receptor Type 1 Products
Research Areas for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (H00000090-M07)
Find related products by research area.
|
Blogs on Activin RIA/ALK-2/Activin Receptor Type 1