Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 410-509 of human Activin RIA/ALK-2/Activin Receptor Type 1 (Q04771). VLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
ACVR1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4)
Background
Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA, BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Block, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Block, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP3-15732) (0)
There are no publications for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP3-15732).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP3-15732) (0)
There are no reviews for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP3-15732).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP3-15732) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Activin RIA/ALK-2/Activin Receptor Type 1 Products
Research Areas for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP3-15732)
Find related products by research area.
|
Blogs on Activin RIA/ALK-2/Activin Receptor Type 1
![Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732] - Western blot analysis of extracts of Mouse brain, using Activin RIA/ALK-2/Activin Receptor Type 1 antibody (NBP3-15732) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/Activin-RIA-ALK-2-Activin-Receptor-Type-1-Antibody-1J7G4-Western-Blot-NBP3-15732-img0001.jpg "Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732] - Western blot analysis of extracts of Mouse brain, using Activin RIA/ALK-2/Activin Receptor Type 1 antibody (NBP3-15732) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
![Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732] - Western blot analysis of extracts of various cell lines, using Activin RIA/ALK-2/Activin Receptor Type 1 antibody (NBP3-15732) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/Activin-RIA-ALK-2-Activin-Receptor-Type-1-Antibody-1J7G4-Western-Blot-NBP3-15732-img0002.jpg "Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732] - Western blot analysis of extracts of various cell lines, using Activin RIA/ALK-2/Activin Receptor Type 1 antibody (NBP3-15732) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Bioactivity BMP-7 [Unconjugated]](https://images.novusbio.com/images/protein/354-bp_recombinant-human-bmp-7-protein-bioactivity-7122020141940.jpg)
![Cell Culture BMP-7 [Unconjugated]](https://images.novusbio.com/images/354-bp_recombinant-human-bmp-7-protein-cell-culture-252023113257..jpg)
![Western Blot BMPR-IA/ALK-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/BMPR-IA_AF346_Western_Blot_9327.jpg)
![Immunohistochemistry BMPR-IA/ALK-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af346_human-bmpr-ia-alk-3-affinity-purified-polyclonal-ab-immunohistochemistry-35202018211.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RI_AF3025_Western_Blot_17081.jpg)
![Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RI_AF3025_Immunocytochemistry_9948.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images/af3025_human-tgf-beta-ri-alk-5-affinity-purified-polyclonal-ab-41202412402510.jpg)
![Immunohistochemistry Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Immunohistochemistry_10106.jpg)
![Western Blot Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Western_Blot_5162.jpg)
![Simple Western Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Simple_Western_16677.jpg)
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![Immunohistochemistry Activin RIIA Antibody [Unconjugated]](https://images.novusbio.com/images2/Activin_RIIA_AF340_Immunohistochemistry_6785.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![Flow Cytometry BMPR-II Antibody [Unconjugated]](https://images.novusbio.com/images2/BMPRII_AF811_Flow_Cytometry_15364.jpg)
![Immunohistochemistry BMPR-II Antibody [Unconjugated]](https://images.novusbio.com/images2/BMPR-II_AF811_Immunohistochemistry_7345.jpg)
![SDS-PAGE BMP-6 [Unconjugated]](https://images.novusbio.com/images2/BMP-6_507-BP_374.jpg)
![Bioactivity BMP-6 [Unconjugated]](https://images.novusbio.com/images2/BMP-6_507-BP_376.jpg)
![Western Blot Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Western_Blot_5347.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Chromatin_Immunoprecipitation_11240.jpg)
![Immunocytochemistry Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Immunocytochemistry_11829.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![SDS-PAGE BMP-9 [Unconjugated]](https://images.novusbio.com/images2/BMP-9_3209-BP_CF_568.jpg)
![Bioactivity BMP-9 [Unconjugated]](https://images.novusbio.com/images2/BMP-9_3209-BP_CF_618.jpg)
![Immunocytochemistry/ Immunofluorescence Smad5 [p Ser463, p Ser465] Antibody (SY09-03)](https://images.novusbio.com/images/Smad5-p-Ser463-p-Ser465-Antibody-SY09-03-Immunocytochemistry-Immunofluorescence-NBP2-67394-img0001.jpg)
![Immunocytochemistry/ Immunofluorescence Smad5 [p Ser463, p Ser465] Antibody (SY09-03)](https://images.novusbio.com/images/Smad5-p-Ser463-p-Ser465-Antibody-SY09-03-Immunocytochemistry-Immunofluorescence-NBP2-67394-img0002.jpg)
![Immunohistochemistry-Paraffin Smad5 [p Ser463, p Ser465] Antibody (SY09-03)](https://images.novusbio.com/images/Smad5-p-Ser463-p-Ser465-Antibody-SY09-03-Immunohistochemistry-Paraffin-NBP2-67394-img0003.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")