Reactivity | HuSpecies Glossary |
Applications | WB, ICC/IF |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | ACOT8 (NP_005460.2, 1 a.a. - 319 a.a.) full-length human protein. MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL |
Specificity | ACOT8 - acyl-CoA thioesterase 8, |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | ACOT8 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Publication using H00010005-B01P | Applications | Species |
---|---|---|
Gondim MV, Wiltzer-Bach L, Maurer B et al. AP-2 Is the Crucial Clathrin Adaptor Protein for CD4 Downmodulation by HIV-1 Nef in Infected Primary CD4+ T Cells. J Virol 2015-12-01 [PMID: 26423947] |
Secondary Antibodies |
Isotype Controls |
Research Areas for ACOT8 Antibody (H00010005-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ACOT8 |
Entrez |
|
Uniprot |
|