![Immunocytochemistry/Immunofluorescence: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human cell line RT4 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/5-Lipoxygenase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56011-img0001.jpg "Immunocytochemistry/Immunofluorescence: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human cell line RT4 shows localization to nucleoplasm. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWY |
| Predicted Species | Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ALOX5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for 5-Lipoxygenase Antibody (NBP2-56011)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ALOX5 |
![Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Analysis in human spleen and skeletal muscle tissues using NBP2-56011 antibody. Corresponding ALOX5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/5-Lipoxygenase-Antibody-Immunohistochemistry-Paraffin-NBP2-56011-img0009.jpg "Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Analysis in human spleen and skeletal muscle tissues using NBP2-56011 antibody. Corresponding ALOX5 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human spleen shows high expression.](http://images.novusbio.com/fullsize/5-Lipoxygenase-Antibody-Immunohistochemistry-Paraffin-NBP2-56011-img0004.jpg "Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human spleen shows high expression.")
![Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human lung shows strong nuclear positivity in macrophages.](http://images.novusbio.com/fullsize/5-Lipoxygenase-Antibody-Immunohistochemistry-Paraffin-NBP2-56011-img0006.jpg "Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human lung shows strong nuclear positivity in macrophages.")
![Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/5-Lipoxygenase-Antibody-Immunohistochemistry-Paraffin-NBP2-56011-img0007.jpg "Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human small intestine shows strong nuclear positivity in lymphoid cells.](http://images.novusbio.com/fullsize/5-Lipoxygenase-Antibody-Immunohistochemistry-Paraffin-NBP2-56011-img0008.jpg "Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody [NBP2-56011] - Staining of human small intestine shows strong nuclear positivity in lymphoid cells.")
![SDS-PAGE Lymphotoxin-alpha/TNF-beta [Unconjugated]](https://images.novusbio.com/images2/Lymphotoxin-alpha_211-TBB_CF_695.jpg)
![Bioactivity Lymphotoxin-alpha/TNF-beta [Unconjugated]](https://images.novusbio.com/images2/Lymphotoxin-alpha_211-TBB_CF_697.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")