Home » ZFYVE9 » ZFYVE9 Proteins » ZFYVE9 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ZFYVE9 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ZFYVE9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZFYVE9.

Source: E. coli

Amino Acid Sequence: NHLCPTSSDSLASVCSPSQLKDDGSIGRDPSMSAITSLTVDSVISSQGTDGCPAVKKQENYIPDEDLTGKISSPRTDLGSPN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZFYVE9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57583.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZFYVE9 Recombinant Protein Antigen

  • Madh-interacting protein
  • MADHIP
  • mothers against decapentaplegic homolog interacting protein
  • mothers against decapentaplegic homolog interacting protein, receptoractivation anchor
  • NSP
  • receptor activation anchor
  • SARAhSARA
  • Smad anchor for receptor activation
  • SMADIPMAD, mothers against decapentaplegic homolog (Drosophila) interacting protein
  • zinc finger FYVE domain-containing protein 9
  • zinc finger, FYVE domain containing 9

Background

ZFYVE9 encodes a double zinc finger (FYVE domain) protein that interacts directly with SMAD2 and SMAD3, and is involved in Alzheimer's disease. SMAD proteins transmit signals from transmembrane serine/threonine kinase receptors to the nucleus. The FYVE domain has been identified in a number of unrelated signaling molecules. This protein functions to recruit SMAD2 to the transforming growth factor-beta receptor. The FYVE domain is required to maintain the normal localization of this protein but is not involved in mediating interaction with SMADs. The C-terminal domain of this protein interacts with the TGFB receptor. This protein is a component of the TGFB pathway that brings the SMAD substrate to the receptor. Three alternatively spliced transcripts encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZFYVE16 Antibody
NBP1-81516
Immunohistochemistry-Paraffin ZFYVE16 Antibody
Immunocytochemistry/ Immunofluorescence ZFYVE16 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Smad2/3 Antibody
[Unconjugated]
AF3797
Western Blot Smad2/3 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]
Immunocytochemistry Smad2/3 Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
TFF2 Antibody
(366508) [Unconjugate
MAB4077
Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
DMPK Antibody
(713931)
MAB6967
Western Blot DMPK Antibody (713931)
Species: Hu
Applications: WB
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(2 Publications)
Species: Hu
Applications: DirELISA, IP, WB
Smad3 Antibody
NB100-56479
Immunocytochemistry/ Immunofluorescence Smad3 Antibody
Western Blot Smad3 Antibody
Immunohistochemistry-Paraffin Smad3 Antibody
(5 Reviews)
(8 Publications)
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
RTN1-A/NSP
Antibody (MON162) - B
NBP1-97677
Immunocytochemistry/ Immunofluorescence RTN1-A/NSP Antibody (MON162) - BSA Free
Immunohistochemistry-Frozen RTN1-A/NSP Antibody (MON162) - BSA Free
(1 Publication)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Smad4 Antibody
[Unconjugated]
AF2097
Chromatin Immunoprecipitation (ChIP) Smad4 Antibody [Unconjugated]
Western Blot Smad4 Antibody [Unconjugated]
Immunocytochemistry Smad4 Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ChIP, ICC, WB
TGF-beta RI/ALK-5
Antibody [Unconjugate ...
AF3025
Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]
Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]
Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ELISA, ICC, WB
HGS Antibody (6D11)
H00009146-M01
Immunocytochemistry/ Immunofluorescence HGS Antibody (6D11)
Western Blot HGS Antibody (6D11)
Sandwich ELISA HGS Antibody (6D11)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, KD, S-ELISA, WB
TGF-beta 1
[Unconjugated]
7754-BH/CF
Bioactivity TGF-beta 1 [Unconjugated]
(53 Publications)
Species: Hu
Applications: BA
Filamin A Antibody
(4E10-1B2)
H00002316-M01
Western Blot Filamin A Antibody (4E10-1B2)
ELISA Filamin A Antibody (4E10-1B2)
Proximity Ligation Assay Filamin A Antibody (4E10-1B2)
(14 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
SLC10A3 Antibody
NBP1-84957
Western Blot SLC10A3 Antibody
Immunohistochemistry-Paraffin SLC10A3 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
ATP5G3 GST (N-Term) P ...
H00000518-P01
SDS-PAGE Recombinant Human ATP5G3 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry Ceruloplasmin Antibody (6C3K9)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Ataxin-3 Antibody
(HL1909) - Azide and ...
NBP3-25371
Immunohistochemistry-Paraffin Ataxin-3 Antibody (HL1909) - Azide and BSA Free
Knockdown Validated Ataxin-3 Antibody (HL1909) - Azide and BSA Free
Western Blot Ataxin-3 Antibody (HL1909) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RPLP2 Antibody
NBP2-15104
Immunocytochemistry/ Immunofluorescence RPLP2 Antibody
Immunohistochemistry-Paraffin RPLP2 Antibody
Western Blot RPLP2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP) (0)

There are no publications for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP) (0)

There are no reviews for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZFYVE9 Products

Research Areas for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP)

Find related products by research area.

Blogs on ZFYVE9

There are no specific blogs for ZFYVE9, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of A549 human lung carcinoma cell line, Jurkat human acute T cell leukemia cell line, HEK293 human embryonic kidney cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 0.5 µg/mL Goat Anti-Human/Mouse Smad2/3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3797) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, recombinant human Smad2 and Smad3 were included. Specific bands for Smad2 were detected at approximately 64 and 58 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Smad2/3 Antibody [Unconjugated]
AF3797

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZFYVE9 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ZFYVE9