Novus Biologicals products are now on bio-techne.com

ZFPM1 Recombinant Protein Antigen

Name: ZFPM1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-47572PEP
Price: 279 USD

Images

There are currently no images for ZFPM1 Protein (NBP2-47572PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ZFPM1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZFPM1. Source: E. coli Amino Acid Sequence: GFISTTRDILYSHLVTNHMVCQPGSKGEIYSPGAGHPATKLPPDSLGSFQQQHTALQGPLASADLGLAPTPSPGLDRKALAEATNGEARAAPQNGGSS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	ZFPM1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47572. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZFPM1 Recombinant Protein Antigen

FOG-1
FOG1ZNF408
FOGfriend of GATA-1
Friend of GATA 1
Friend of GATA protein 1
ZFN89A
Zinc finger protein 89A
Zinc finger protein multitype 1
zinc finger protein ZFPM1
zinc finger protein, multitype 1
ZNF89A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GATA-1 Antibody
(4F5) - BSA Free

NBP1-47492

Immunocytochemistry/ Immunofluorescence GATA-1 Antibody (4F5) - BSA Free

Immunohistochemistry-Paraffin GATA-1 Antibody (4F5) - BSA Free

(1 Review)

(2 Publications)

Species: Pm, Hu

Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB

FOG2 Antibody

NBP1-32895

(1 Review)

(1 Publication)

Species: Hu, Mu, Rt

Applications: WB

GATA-2 Antibody
[Unconjugated]

AF2046

Simple Western GATA-2 Antibody [Unconjugated]

(11 Publications)

Species: Hu, Mu

Applications: ICC, IHC, Simple Western, WB

GATA-2 Antibody
[Unconjugated]

AF2046

(11 Publications)

Species: Hu, Mu

Applications: ICC, IHC, Simple Western, WB

Serine Dehydratase
Antibody (OTI3D3)

NBP2-01506

Western Blot Serine Dehydratase Antibody (OTI3D3)

Species: Hu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

SDHB Antibody

NBP1-87069

(16 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB

SCL/Tal1 Antibody
(OTI5H1)

NBP2-01488

Flow Cytometry SCL/Tal1 Antibody (OTI5H1)

Immunocytochemistry/ Immunofluorescence SCL/Tal1 Antibody (OTI5H1)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

SDSL Antibody
(OTI1A8)

NBP2-45978

Immunohistochemistry SDSL Antibody (OTI1A8)

Species: Hu

Applications: Flow, IHC, IHC-P, WB

QRSL Antibody

NBP1-87992

Immunohistochemistry-Paraffin QRSL Antibody

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

Myosin Heavy Chain
Antibody (MF20) [Unco ...

MAB4470

Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]

(1 Review)

(165 Publications)

Species: All-Multi

Applications: Flow, ICC, IHC, WB

GATA-4 Antibody -
BSA Free

NBP2-24585

(1 Review)

(2 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, WB

Nuclear Factor
Erythroid Derived 2 A ...

NBP1-82580

Species: Hu

Applications: IHC, IHC-P, Simple Western, WB

GATA-4 Antibody -
BSA Free

NBP2-24585

(1 Review)

(2 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, WB

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

GLYAT Antibody

NBP2-58917

Immunohistochemistry-Paraffin GLYAT Antibody

Species: Hu

Applications: IHC, IHC-P, WB

CRAT Antibody

NBP1-86616

Immunohistochemistry-Paraffin CRAT Antibody

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

Erythropoietin/EPO
[HRP]

MEP00B

(105 Publications)

Species: Mu

Applications: ELISA

Endothelial Lipase
Antibody

NB400-111

Western Blot Endothelial Lipase Antibody

(6 Publications)

Species: Hu, Mu(-)

Applications: ICC/IF, IHC, IHC-Fr, WB

CtBP1 Antibody
(2G7)

H00001487-M01

Immunocytochemistry/ Immunofluorescence CtBP1 Antibody (2G7)

Immunohistochemistry-Paraffin CtBP1 Antibody (2G7)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB

ZFPM1 Recombinant
Protein Antigen

NBP2-47572PEP

Species: Hu

Applications: AC

Publications for ZFPM1 Protein (NBP2-47572PEP) (0)

There are no publications for ZFPM1 Protein (NBP2-47572PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFPM1 Protein (NBP2-47572PEP) (0)

There are no reviews for ZFPM1 Protein (NBP2-47572PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZFPM1 Protein (NBP2-47572PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZFPM1 Products

Research Areas for ZFPM1 Protein (NBP2-47572PEP)

Find related products by research area.

Blogs on ZFPM1

There are no specific blogs for ZFPM1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Myosin Heavy Chain was detected in immersion fixed paraffin-embedded sections of human skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.

Myosin Heavy Chain Antibody (MF20) [Unconjugated]
MAB4470

Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH-3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2.

Catalase Antibody [Unconjugated]
AF3398

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our ZFPM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

ZFPM1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

ZFPM1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

ZFPM1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for ZFPM1 Recombinant Protein Antigen

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ZFPM1 Protein (NBP2-47572PEP) (0)

Reviews for ZFPM1 Protein (NBP2-47572PEP) (0)

FAQs for ZFPM1 Protein (NBP2-47572PEP) (0)

Additional ZFPM1 Products

Research Areas for ZFPM1 Protein (NBP2-47572PEP)

Blogs on ZFPM1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics