In looking at the Zeb1 antibodies on your website, the molecular weights of Zeb1 detected by several antibodies are different. Why is this?

Name: ZEB1 Antibody
Brand: Novus Biologicals
SKU: NBP1-88845
Price: 549 USD

Question

Accepted Answer

ZEB1 is a rather large protein and undergoes a lot of post translational modifications such as phosphorylation and glycosylation (please see: UniProt P37275). The reason band patterns are different in the images may be due to sample type and how highly modified the ZEB1 protein is that the antibody is detecting. The more post translational modifications the higher you will detect the protein.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB, ICC/IF, IHC, ChIP
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated
Concentration	0.2 mg/ml

Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
Marker	Mesenchymal Cells Marker
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	ZEB1
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.2) and 40% Glycerol
Preservative	0.02% Sodium Azide
Concentration	0.2 mg/ml
Purity	Immunogen affinity purified

Publications using NBP1-88845	Applications	Species
Han Y, Villarreal-Ponce A, Gutierrez G et al. Coordinate control of basal epithelial cell fate and stem cell maintenance by core EMT transcription factor Zeb1 Cell reports 2022-01-11 [PMID: 35021086] (IF/IHC, Chip Cytometry, Mouse)	IF/IHC, Chip Cytometry	Mouse
Feldker N, Ferrazzi F, Schuhwerk H et al. Genome-wide cooperation of EMT transcription factor ZEB1 with YAP and AP-1 in breast cancer EMBO J. 2020-07-21 [PMID: 32692442] (GS, Human)	GS	Human
Bi J, Yang S, Li L et al. Metadherin enhances vulnerability of cancer cells to ferroptosis Cell Death Dis 2019-09-17 [PMID: 31527591] (WB, Human)	WB	Human
Vanneste M, Huang Q, Li M et al. High content screening identifies monensin as an EMT-selective cytotoxic compound Sci Rep 2019-02-04 [PMID: 30718715] (WB, Human)	WB	Human
Yao X, Sun S, Zhou X et al. Clinicopathological significance of ZEB-1 and E-cadherin proteins in patients with oral cavity squamous cell carcinoma Onco Targets Ther 2017-02-28 [PMID: 28243114] (IHC-P, Human)	IHC-P	Human
A Barbachano, A Fernandez-Barral, F Pereira et al. SPROUTY-2 represses the epithelial phenotype of colon carcinoma cells via upregulation of ZEB1 mediated by ETS1 and miR-200/miR-150. Oncogene 2015-10-12 [PMID: 26455323] (WB, Human)	WB	Human
Asnaghi L, Gezgin G, Tripathy A et al. EMT-associated factors promote invasive properties of uveal melanoma cells. Mol Vis 2015-01-01 [PMID: 26321866] (WB, Human)	WB	Human
Mock K, Preca BT, Brummer T et al. The EMT-activator ZEB1 induces bone metastasis associated genes including BMP-inhibitors. Oncotarget 2015-06-10 [PMID: 25973542] (WB, Human)	WB	Human
Meidhof S, Brabletz S, Lehmann W et al. ZEB1-associated drug resistance in cancer cells is reversed by the class I HDAC inhibitor mocetinostat. EMBO Mol Med 2015-06-01 [PMID: 25872941] (IF/IHC, WB, ICC/IF, Human)	IF/IHC, WB, ICC/IF	Human
Claudio Isella, Andrea Terrasi, Sara Erika Bellomo et al. Stromal contribution to the colorectal cancer transcriptome. Nature Genetics 2015-02-23 [PMID: 25706627] (IF/IHC, Human)	IF/IHC	Human
Davidson B, Holth A, Hellesylt E et al. The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions. Hum Pathol 2015-01-01 [PMID: 25455994] (IF/IHC, Human)	IF/IHC	Human
Ceppi P, Hadji A, Kohlhapp FJ et al. CD95 and CD95L promote and protect cancer stem cells. Nat Commun 2014-11-04 [PMID: 25366259] (ICC/IF, WB, Human)	ICC/IF, WB	Human
Zeindl-Eberhart E, Brandl L, Liebmann S et al. Epithelial-Mesenchymal Transition Induces Endoplasmic-Reticulum-Stress Response in Human Colorectal Tumor Cells. PLoS One 2014-01-01 [PMID: 24498091]
Roca H, Hernandez J, Weidner S et al. Transcription Factors OVOL1 and OVOL2 Induce the Mesenchymal to Epithelial Transition in Human Cancer. PLoS One 2013-01-01 [PMID: 24124593]
Pieraccioli M, Imbastari F, Antonov A et al. Activation of miR200 by c-Myb depends on ZEB1 expression and miR200 promoter methylation. Cell Cycle 2013-07-15 [PMID: 24067373] (WB, Human)	WB	Human
Jakobsen KR, Sorensen E, Brondum KK et al. Direct RNA sequencing mediated identification of mRNA localized in protrusions of human MDA-MB-231 metastatic breast cancer cells. J Mol Signal 2013-09-01 [PMID: 24004954]
Werner S, Frey S, Riethdorf S et al. Dual Roles of the Transcription Factor Grainyhead-like 2 (GRHL2) in Breast Cancer. J Biol Chem. 2013-06-29 [PMID: 23814079] (WB, Chemotaxis, Human)	WB, Chemotaxis	Human
Konoeda C, Koinuma D, Morishita Y et al. Epithelial to Mesenchymal Transition in Murine Tracheal Allotransplantation: An Immunohistochemical Observation. Transplant Proc 2013-06-01 [PMID: 23769046]
PACURARI M, ADDISON JB, BONDALAPATI N et al. The microRNA-200 family targets multiple non-small cell lung cancer prognostic markers in H1299 cells and BEAS-2B cells. Int J Oncol 2013-08-01 [PMID: 23708087]
Vannier C, Mock K, Brabletz T, Driever W. Zeb1 Regulates E-cadherin and Epcam (Epithelial Cell Adhesion Molecule) Expression to Control Cell Behavior in Early Zebrafish Development. J Biol Chem 2013-06-28 [PMID: 23667256]
De Sousa E Melo F, Wang X, Jansen M et al. Poor-prognosis colon cancer is defined by a molecularly distinct subtype and develops from serrated precursor lesions. Nat Med 2013-05-01 [PMID: 23584090]
Hanna JA, Wimberly H, Kumar S et al. Quantitative analysis of microRNAs in tissue microarrays by in situ hybridization. Biotechniques 2012-04-01 [PMID: 22482439]
Jia B, Liu H, Kong Q et al. Overexpression of ZEB1 associated with metastasis and invasion in patients with gastric carcinoma. Mol Cell Biochem 2012-07-01 [PMID: 22466758]
Show All 23 Publications. Collapse Publications.

ZEB1 Antibody

Species Glossary

Images

Product Details

Order Details

ZEB1 Antibody Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Alternate Names for ZEB1 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ZEB1 Antibody (NBP1-88845)(23)

Reviews for ZEB1 Antibody (NBP1-88845) (0)

Product General Protocols

Video Protocols

FAQs for ZEB1 Antibody (NBP1-88845). (Showing 1 - 1 of 1 FAQs).

Secondary Antibodies

Isotype Controls

Additional ZEB1 Products

Research Areas for ZEB1 Antibody (NBP1-88845)

Blogs on ZEB1.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Gene Symbol	ZEB1
Entrez	6935(Human)
Uniprot	P37275()