Home » XCR1/CCXCR1 » XCR1/CCXCR1 Proteins » XCR1/CCXCR1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

XCR1/CCXCR1 Recombinant Protein Antigen

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related XCR1/CCXCR1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-88143PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

XCR1/CCXCR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human XCR1/CCXCR1.

Source: E. coli

Amino Acid Sequence: MESSGNPESTTFFYYDLQSQPCENQAWVFATLA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
XCR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88143.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for XCR1/CCXCR1 Recombinant Protein Antigen

  • CCXCR1
  • CCXCR1XC chemokine receptor 1
  • chemokine (C motif) receptor 1
  • chemokine XC receptor 1
  • G protein-coupled receptor 5
  • GPR5
  • GPR5chemokine (C motif) XC receptor 1
  • G-protein coupled receptor 5
  • Lymphotactin receptor
  • XCR1

Background

CCXCR1 receptor transcripts have been identified in placenta, spleen, and thymus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

XCL1/Lymphotactin
Antibody [Unconjugate ...
AF486
Neutralization XCL1/Lymphotactin Antibody [Unconjugated]
(7 Publications)
Species: Mu
Applications: IHC, Neut, WB
Doublecortin
Antibody
NBP1-72042
Western Blot Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
CCR1 Antibody
(53504) [Unconjugated
MAB145
Flow Cytometry CCR1 Antibody (53504) [Unconjugated]
(1 Review)
(26 Publications)
Species: Hu
Applications: CyTOF-ready, Flow
CC Chemokine
Receptor D6 Antibody ...
MAB1364
Flow Cytometry CC Chemokine Receptor D6 Antibody (196124) [Unconjugated]
(5 Publications)
Species: Hu
Applications: CyTOF-ready, Flow
CCR5 Antibody
(45531) [Unconjugated
MAB182
Flow Cytometry CCR5 Antibody (45531) [Unconjugated]
Neutralization CCR5 Antibody (45531) [Unconjugated]
Immunocytochemistry CCR5 Antibody (45531) [Unconjugated]
(1 Review)
(32 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
CCR3 Antibody
(61828)
MAB155
Immunohistochemistry CCR3 Antibody (61828)
Neutralization CCR3 Antibody (61828)
(20 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
CX3CR1 Antibody
[Unconjugated]
AF5825
Flow Cytometry CX3CR1 Antibody [Unconjugated]
Western Blot CX3CR1 Antibody [Unconjugated]
(1 Review)
(16 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
CXCR1/IL-8RA
Antibody (42705) [Unc ...
MAB330
Flow Cytometry CXCR1/IL-8RA Antibody (42705) [Unconjugated]
Neutralization CXCR1/IL-8RA Antibody (42705) [Unconjugated]
(50 Publications)
Species: Hu
Applications: CyTOF-reported, Flow, IHC, Neut
CCR8 Antibody
(191704) [Unconjugate
MAB1429
Flow Cytometry CCR8 Antibody (191704) [Unconjugated]
Neutralization CCR8 Antibody (191704) [Unconjugated]
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Neut
CCR11 Antibody
(674144) [Unconjugate
MAB6899
Flow Cytometry CCR11 Antibody (674144) [Unconjugated]
Species: Hu
Applications: CyTOF-ready, Flow
CCR2 Antibody
(48607) [Unconjugated
MAB150
Immunohistochemistry CCR2 Antibody (48607) [Unconjugated]
Flow Cytometry CCR2 Antibody (48607) [Unconjugated]
(45 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC
CCRL2/LCCR
Antibody (498321)
MAB5519
Flow Cytometry CCRL2/LCCR Antibody (498321)
Immunocytochemistry CCRL2/LCCR Antibody (498321)
(1 Publication)
Species: Mu
Applications: CyTOF-ready, Flow, ICC
CXCR4 Antibody
(44716) [Unconjugated
MAB172
Immunohistochemistry CXCR4 Antibody (44716) [Unconjugated]
Neutralization CXCR4 Antibody (44716) [Unconjugated]
Immunohistochemistry CXCR4 Antibody (44716) [Unconjugated]
(2 Reviews)
(87 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc

Thrombomodulin/BDCA-3 ...
AF3894
Immunocytochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]
Immunohistochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]
(14 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
CCR4 Antibody
(205410) [Unconjugate
MAB1567
Flow Cytometry CCR4 Antibody (205410) [Unconjugated]
(28 Publications)
Species: Hu
Applications: CyTOF-reported, Flow
CNOT6 Antibody
NBP1-86564
Immunohistochemistry-Paraffin CNOT6 Antibody
Immunocytochemistry/ Immunofluorescence CNOT6 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CXCR6 Antibody
(56811) [Unconjugated
MAB699
Flow Cytometry CXCR6 Antibody (56811) [Unconjugated]
Flow Cytometry CXCR6 Antibody (56811) [Unconjugated]
Immunocytochemistry/ Immunofluorescence CXCR6 Antibody (56811) [Unconjugated]
(26 Publications)
Species: Hu
Applications: CyTOF-reported, Flow
CCR7 Antibody
(150503) [Unconjugate
MAB197
Immunocytochemistry CCR7 Antibody (150503) [Unconjugated]
Immunohistochemistry CCR7 Antibody (150503) [Unconjugated]
Neutralization CCR7 Antibody (150503) [Unconjugated]
(1 Review)
(103 Publications)
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
XCR1/CCXCR1
Recombinant Protein A
NBP1-88143PEP
XCR1/CCXCR1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for XCR1/CCXCR1 Recombinant Protein Antigen (NBP1-88143PEP) (0)

There are no publications for XCR1/CCXCR1 Recombinant Protein Antigen (NBP1-88143PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XCR1/CCXCR1 Recombinant Protein Antigen (NBP1-88143PEP) (0)

There are no reviews for XCR1/CCXCR1 Recombinant Protein Antigen (NBP1-88143PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for XCR1/CCXCR1 Recombinant Protein Antigen (NBP1-88143PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XCR1/CCXCR1 Products

Research Areas for XCR1/CCXCR1 Recombinant Protein Antigen (NBP1-88143PEP)

Find related products by research area.

Blogs on XCR1/CCXCR1

There are no specific blogs for XCR1/CCXCR1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our XCR1/CCXCR1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol XCR1