Home » WDR77 » WDR77 Antibodies » WDR77 Antibody
Novus Biologicals products are now on bio-techne.com

WDR77 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry: WDR77 Antibody [NBP1-82780] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.
Immunohistochemistry: WDR77 Antibody [NBP1-82780] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

WDR77 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR77
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WDR77 Protein (NBP1-82780PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR77 Antibody

  • Androgen receptor cofactor p44
  • MEP-50
  • MEP50Nbla10071
  • methylosome protein 50
  • MGC2722
  • p44
  • p44/Mep50
  • RP11-552M11.3
  • WD repeat domain 77
  • WD repeat-containing protein 77

Background

WDR77 is a component of the 20S PRMT5 (MIM 604045)-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins (see MIM 601061). This modification targets Sm proteins to the survival of motor neurons (SMN) complex (see MIM 600354) for assembly into small nuclear ribonucleoprotein core particles (Friesen et al., 2002 [PubMed 11756452]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
CDKL1 Antibody
(5B11)
H00008814-M01
Immunocytochemistry/ Immunofluorescence CDKL1 Antibody (5B11)
Immunohistochemistry-Paraffin CDKL1 Antibody (5B11)
Western Blot CDKL1 Antibody (5B11)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NUP43 Antibody
NBP1-88792
Western Blot NUP43 Antibody
Immunohistochemistry-Paraffin NUP43 Antibody
Western Blot NUP43 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PSMC6 Antibody
(2C4)
H00005706-M02
Western Blot PSMC6 Antibody (2C4)
Immunocytochemistry/ Immunofluorescence PSMC6 Antibody (2C4)
Western Blot PSMC6 Antibody (2C4)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
CDK20 Antibody
NBP1-91214
Immunohistochemistry-Paraffin CDK20 Antibody
Immunohistochemistry-Paraffin CDK20 Antibody
Immunohistochemistry-Paraffin CDK20 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
p38 gamma/SAPK3
Antibody [Unconjugate
AF1347
Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]
Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]
Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]
(8 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin SGSM3 Antibody
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody
Western Blot SGSM3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
Crk Antibody
(3G11E8) - BSA Free
NBP2-37568
ELISA Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
POLDIP2 Antibody
NBP1-68874
Western Blot POLDIP2 Antibody
Western Blot POLDIP2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Flow Cytometry GRAP2 Antibody (OTI1G2)
Flow Cytometry GRAP2 Antibody (OTI1G2)
Western Blot GRAP2 Antibody (OTI1G2)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AHSA1 Antibody
(1A2-A8)
H00010598-M01
Western Blot AHSA1 Antibody (1A2-A8)
Sandwich ELISA AHSA1 Antibody (1A2-A8)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
AIMP2 Antibody
NBP1-81575
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB

Publications for WDR77 Antibody (NBP1-82780) (0)

There are no publications for WDR77 Antibody (NBP1-82780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR77 Antibody (NBP1-82780) (0)

There are no reviews for WDR77 Antibody (NBP1-82780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for WDR77 Antibody (NBP1-82780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR77 Products

Research Areas for WDR77 Antibody (NBP1-82780)

Find related products by research area.

Blogs on WDR77

There are no specific blogs for WDR77, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR77 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol WDR77