![Western Blot: VPS37A Antibody [NBP1-83528] - Analysis in rat cell line NBT-II and mouse cell line NIH-3T3.](http://images.novusbio.com/fullsize/VPS37A-Antibody-Western-Blot-NBP1-83528-img0020.jpg "Western Blot: VPS37A Antibody [NBP1-83528] - Analysis in rat cell line NBT-II and mouse cell line NIH-3T3.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | VPS37A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for VPS37A Antibody (NBP1-83528)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | VPS37A |
![Immunocytochemistry/Immunofluorescence: VPS37A Antibody [NBP1-83528] - Staining of human cell line U-251 MG shows localization to cytosol, centrosome and vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/VPS37A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83528-img0014.jpg "Immunocytochemistry/Immunofluorescence: VPS37A Antibody [NBP1-83528] - Staining of human cell line U-251 MG shows localization to cytosol, centrosome and vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: VPS37A Antibody [NBP1-83528] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.](http://images.novusbio.com/fullsize/VPS37A-Antibody-Immunohistochemistry-Paraffin-NBP1-83528-img0018.jpg "Immunohistochemistry-Paraffin: VPS37A Antibody [NBP1-83528] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.")
![Western Blot: VPS37A Antibody [NBP1-83528] - Analysis in human testis tissue.](http://images.novusbio.com/fullsize/VPS37A-Antibody-Western-Blot-NBP1-83528-img0019.jpg "Western Blot: VPS37A Antibody [NBP1-83528] - Analysis in human testis tissue.")
![Immunohistochemistry-Paraffin: VPS37A Antibody [NBP1-83528] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/VPS37A-Antibody-Immunohistochemistry-Paraffin-NBP1-83528-img0015.jpg "Immunohistochemistry-Paraffin: VPS37A Antibody [NBP1-83528] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: VPS37A Antibody [NBP1-83528] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/VPS37A-Antibody-Immunohistochemistry-Paraffin-NBP1-83528-img0016.jpg "Immunohistochemistry-Paraffin: VPS37A Antibody [NBP1-83528] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: VPS37A Antibody [NBP1-83528] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/VPS37A-Antibody-Immunohistochemistry-Paraffin-NBP1-83528-img0017.jpg "Immunohistochemistry-Paraffin: VPS37A Antibody [NBP1-83528] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")