Home » VGLUT2 » VGLUT2 Proteins » VGLUT2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

VGLUT2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for VGLUT2 Recombinant Protein Antigen (NBP2-46640PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

VGLUT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC17A6.

Source: E. coli

Amino Acid Sequence: CGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC17A6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46640.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VGLUT2 Recombinant Protein Antigen

  • differentiation-associated BNPI
  • differentiation-associated Na(+)-dependent inorganic phosphate cotransporter
  • differentiation-associated Na-dependent inorganic phosphate cotransporter
  • DNPI
  • solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6
  • solute carrier family 17 member 6
  • vesicular glutamate transporter 2
  • VGLUT2

Background

VGLUT2 is a sodium dependent inorganic phosphate cotransporter that is involved in the calcium dependent glutamate release from astrocytes. It is expressed in only a subset of neurons, localized to synaptic vesicles, at synapses exhibiting classical excitatory features. VGLUT2 mRNA is found in brain regions that lack VGLUT1, a related protein also displaying sodium dependent inorganic phosphate cotransporter activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

VGLUT1 Antibody
NBP3-13165
Immunohistochemistry-Paraffin VGLUT1 Antibody
Immunohistochemistry-Frozen VGLUT1 Antibody
Western Blot VGLUT1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
VIAAT/SLC32A1/VGAT
Antibody
NBP2-20857
Immunohistochemistry-Paraffin VIAAT/SLC32A1/VGAT Antibody
Immunocytochemistry/ Immunofluorescence VIAAT/SLC32A1/VGAT Antibody
Western Blot VIAAT/SLC32A1/VGAT Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
VGluT3 Antibody
NBP1-25973
Immunohistochemistry-Paraffin VGluT3 Antibody
Western Blot VGluT3 Antibody
Immunohistochemistry-Paraffin VGluT3 Antibody
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
GAD1/GAD67
Antibody [Unconjugate
AF2086
Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]
Western Blot GAD1/GAD67 Antibody [Unconjugated]
Simple Western GAD1/GAD67 Antibody [Unconjugated]
(13 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/ Immunofluorescence Glutamine Synthetase Antibody
Western Blot Glutamine Synthetase Antibody
Immunohistochemistry Glutamine Synthetase Antibody
(1 Review)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(232 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Calbindin D-28K
Antibody
NBP2-50028
Western Blot Calbindin D-28K Antibody
Immunocytochemistry/ Immunofluorescence Calbindin D-28K Antibody
Western Blot Calbindin D-28K Antibody
(1 Review)
(13 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Substance P
Antibody (266815)
MAB4375
Immunohistochemistry Substance P Antibody (266815)
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC
Synaptophysin
Antibody
NB300-653
Immunohistochemistry-Frozen Synaptophysin Antibody
Western Blot Synaptophysin Antibody
Immunohistochemistry-Paraffin Synaptophysin Antibody
(2 Reviews)
(11 Publications)
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
GAD2/GAD65
Antibody [Unconjugate
AF2247
Immunohistochemistry GAD2/GAD65 Antibody [Unconjugated]
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, WB
Choline
Acetyltransferase/ChA
NBP1-30052
Immunohistochemistry-Paraffin Choline Acetyltransferase/ChAT Antibody
Immunocytochemistry/ Immunofluorescence Choline Acetyltransferase/ChAT Antibody
Immunocytochemistry/ Immunofluorescence Choline Acetyltransferase/ChAT Antibody
(24 Publications)
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
VAChT/SLC18A3
Antibody
NB100-91348
Immunohistochemistry-Paraffin VAChT/SLC18A3 Antibody
Western Blot VAChT/SLC18A3 Antibody
Immunohistochemistry-Paraffin VAChT/SLC18A3 Antibody
(2 Publications)
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Parvalbumin
Antibody - BSA Free
NB120-11427
Immunohistochemistry-Paraffin Parvalbumin Antibody - BSA Free
Immunohistochemistry Parvalbumin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Parvalbumin Antibody - BSA Free
(32 Publications)
Species: Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Procalcitonin
Antibody (44D9)
NB120-14817
Procalcitonin Antibody (44D9)
(1 Review)
(11 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Calretinin Antibody
NBP1-88220
Immunocytochemistry/ Immunofluorescence Calretinin Antibody
Western Blot Calretinin Antibody
Immunohistochemistry-Paraffin Calretinin Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
nNOS Antibody
NB100-858
Immunocytochemistry/ Immunofluorescence nNOS Antibody
Flow Cytometry nNOS Antibody
Immunocytochemistry/ Immunofluorescence nNOS Antibody
(1 Review)
(15 Publications)
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
EN-RAGE/S100A12
Antibody [Unconjugate
AF1052
Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]
Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]
Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]
(3 Reviews)
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB

Publications for VGLUT2 Recombinant Protein Antigen (NBP2-46640PEP) (0)

There are no publications for VGLUT2 Recombinant Protein Antigen (NBP2-46640PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VGLUT2 Recombinant Protein Antigen (NBP2-46640PEP) (0)

There are no reviews for VGLUT2 Recombinant Protein Antigen (NBP2-46640PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VGLUT2 Recombinant Protein Antigen (NBP2-46640PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VGLUT2 Products

Array NBP2-46640PEP

Research Areas for VGLUT2 Recombinant Protein Antigen (NBP2-46640PEP)

Find related products by research area.

Blogs on VGLUT2

There are no specific blogs for VGLUT2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Tyrosine Hydroxylase Antibody
NB300-109

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VGLUT2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC17A6