Vang-like Protein 2/VANGL2 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRV |
Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
VANGL2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Vang-like Protein 2/VANGL2 Antibody
Background
VANGL2 is involved in the control of early morphogenesis and patterning of both axial midline structures and the development of neural plate. It plays a role in the regulation of planar cell polarity, particularly in the orientation of stereociliary bundles in the cochlea. It is required for polarization and movement of myocardializing cells in the outflow tract and seems to act via RHOA signaling to regulate this process. The VANGL2 gene encodes a homolog of Drosophila 'strabismus/Van Gogh' (Stbm/Vang), a component of the frizzled-dishevelled tissue polarity pathway.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ICC/IF, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Ch, Hu, Mu, Pm, Rt, Xp, Ze
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for Vang-like Protein 2/VANGL2 Antibody (NBP1-81428) (0)
There are no publications for Vang-like Protein 2/VANGL2 Antibody (NBP1-81428).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Vang-like Protein 2/VANGL2 Antibody (NBP1-81428) (0)
There are no reviews for Vang-like Protein 2/VANGL2 Antibody (NBP1-81428).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Vang-like Protein 2/VANGL2 Antibody (NBP1-81428) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Vang-like Protein 2/VANGL2 Products
Research Areas for Vang-like Protein 2/VANGL2 Antibody (NBP1-81428)
Find related products by research area.
|
Blogs on Vang-like Protein 2/VANGL2