![Western Blot: TMSB4Y Antibody (6G4) [H00009087-M05] - Analysis of TMSB4Y expression in transfected 293T cell line by TMSB4Y monoclonal antibody (M05), clone 6G4. Lane 1: TMSB4Y transfected lysatE (5 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/TMSB4Y-Antibody-6G4-Western-Blot-H00009087-M05-img0003.jpg "Western Blot: TMSB4Y Antibody (6G4) [H00009087-M05] - Analysis of TMSB4Y expression in transfected 293T cell line by TMSB4Y monoclonal antibody (M05), clone 6G4. Lane 1: TMSB4Y transfected lysatE (5 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 6G4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | TMSB4Y (NP_004193.1, 1 a.a. ~ 44 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TMSB4Y |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is useful for ELISA, Western Blot |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunohistochemistry A33/GPA33 Antibody [Unconjugated]](https://images.novusbio.com/images2/A33_AF3080_Immunohistochemistry_6771.jpg)
![Flow Cytometry A33/GPA33 Antibody [Unconjugated]](https://images.novusbio.com/images2/A33_AF3080_Flow_Cytometry_8193.jpg)
![Western Blot A33/GPA33 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3080_human-a33-affinity-purified-polyclonal-ab-western-blot-2582021113759.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: TMSB4Y Antibody (6G4) [H00009087-M05] - Analysis of monoclonal antibody to TMSB4Y on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/TMSB4Y-Antibody-6G4-Immunocytochemistry-Immunofluorescence-H00009087-M05-img0001.jpg "Immunocytochemistry/Immunofluorescence: TMSB4Y Antibody (6G4) [H00009087-M05] - Analysis of monoclonal antibody to TMSB4Y on HeLa cell. Antibody concentration 10 ug/ml")
![Sandwich ELISA: TMSB4Y Antibody (6G4) [H00009087-M05] - Detection limit for recombinant GST tagged TMSB4Y is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/TMSB4Y-Antibody-6G4-Sandwich-ELISA-H00009087-M05-img0002.jpg "Sandwich ELISA: TMSB4Y Antibody (6G4) [H00009087-M05] - Detection limit for recombinant GST tagged TMSB4Y is 0.1 ng/ml as a capture antibody.")
![Flow Cytometry CD99 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD99_AF3968_Flow_Cytometry_8220.jpg)
![Western Blot CD99 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD99_AF3968_Western_Blot_23993.jpg)
![Simple Western CD99 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD99_AF3968_Simple_Western_24089.jpg)
