![Western Blot: USP10 Antibody [NBP1-83029] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize/USP10-Antibody-Western-Blot-NBP1-83029-img0008.jpg "Western Blot: USP10 Antibody [NBP1-83029] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KITPDGITKEASYGSIDCQYPGSALALDGSSNVEAEVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEALVNGHANSAVPNSVSAEDAEFMGDMPPPLTPRTCNSPQNSTDS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | USP10 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for USP10 Antibody (NBP1-83029)Find related products by research area.
|
|
Beclin 1: Regulator of Autophagy and Apoptosis Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | USP10 |
![Immunocytochemistry/Immunofluorescence: USP10 Antibody [NBP1-83029] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/USP10-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83029-img0006.jpg "Immunocytochemistry/Immunofluorescence: USP10 Antibody [NBP1-83029] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/USP10-Antibody-Immunohistochemistry-Paraffin-NBP1-83029-img0017.jpg "Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human lymph node.](http://images.novusbio.com/fullsize/USP10-Antibody-Immunohistochemistry-Paraffin-NBP1-83029-img0010.jpg "Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human colon.](http://images.novusbio.com/fullsize/USP10-Antibody-Immunohistochemistry-Paraffin-NBP1-83029-img0011.jpg "Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human colon.")
![Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human testis.](http://images.novusbio.com/fullsize/USP10-Antibody-Immunohistochemistry-Paraffin-NBP1-83029-img0012.jpg "Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human testis.")
![Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/USP10-Antibody-Immunohistochemistry-Paraffin-NBP1-83029-img0013.jpg "Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human cerebral cortex, fallopian tube, prostate and stomach using Anti-USP10 antibody NBP1-83029 (A) shows similar protein distribution across tissues to independent antibody NBP1-83028 (B).](http://images.novusbio.com/fullsize/USP10-Antibody-Immunohistochemistry-Paraffin-NBP1-83029-img0014.jpg "Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human cerebral cortex, fallopian tube, prostate and stomach using Anti-USP10 antibody NBP1-83029 (A) shows similar protein distribution across tissues to independent antibody NBP1-83028 (B).")
![Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/USP10-Antibody-Immunohistochemistry-Paraffin-NBP1-83029-img0015.jpg "Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/USP10-Antibody-Immunohistochemistry-Paraffin-NBP1-83029-img0016.jpg "Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/USP10-Antibody-Immunohistochemistry-Paraffin-NBP1-83029-img0018.jpg "Immunohistochemistry-Paraffin: USP10 Antibody [NBP1-83029] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")