![Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Analysis in human esophagus and skeletal muscle tissues using NBP2-30852antibody. Corresponding UPP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Uridine-Phosphorylase-1-UPP1-Antibody-Immunohistochemistry-Paraffin-NBP2-30852-img0011.jpg "Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Analysis in human esophagus and skeletal muscle tissues using NBP2-30852antibody. Corresponding UPP1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UPP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Uridine Phosphorylase 1/UPP1 Antibody (NBP2-30852)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Analysis in control (vector only transfected HEK293T lysate) and UPP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Uridine-Phosphorylase-1-UPP1-Antibody-Western-Blot-NBP2-30852-img0009.jpg "Western Blot: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Analysis in control (vector only transfected HEK293T lysate) and UPP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Uridine-Phosphorylase-1-UPP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30852-img0008.jpg "Immunocytochemistry/Immunofluorescence: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Uridine-Phosphorylase-1-UPP1-Antibody-Immunohistochemistry-Paraffin-NBP2-30852-img0017.jpg "Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human esophogus shows moderate cytoplasmic in squamous epithelial cells.](http://images.novusbio.com/fullsize/Uridine-Phosphorylase-1-UPP1-Antibody-Immunohistochemistry-Paraffin-NBP2-30852-img0012.jpg "Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human esophogus shows moderate cytoplasmic in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human fallopian tube shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Uridine-Phosphorylase-1-UPP1-Antibody-Immunohistochemistry-Paraffin-NBP2-30852-img0014.jpg "Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human fallopian tube shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human oral mucosa shows moderate cytoplasmic and membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/Uridine-Phosphorylase-1-UPP1-Antibody-Immunohistochemistry-Paraffin-NBP2-30852-img0015.jpg "Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human oral mucosa shows moderate cytoplasmic and membranous positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human skin shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/Uridine-Phosphorylase-1-UPP1-Antibody-Immunohistochemistry-Paraffin-NBP2-30852-img0016.jpg "Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody [NBP2-30852] - Staining of human skin shows no positivity in squamous epithelial cells as expected.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")