Home » ULK1 » ULK1 Proteins » ULK1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ULK1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ULK1 Recombinant Protein Antigen (NBP2-56576PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ULK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to ULK1.

Source: E. coli

Amino Acid Sequence: TSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRNLRGSPKLPDFLQRNP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ULK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56576.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ULK1 Recombinant Protein Antigen

  • ATG1 autophagy related 1 homolog
  • ATG1
  • ATG1A
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ38455
  • FLJ46475
  • hATG1
  • KIAA0722
  • serine/threonine-protein kinase ULK1
  • ULK1
  • unc-51 (C. elegans)-like kinase 1
  • UNC51
  • Unc51.1
  • unc-51-like kinase 1 (C. elegans)
  • Unc-51-like kinase 1

Background

ULK1 belongs to the serine/threonine protein kinase family. It is involved in axon growth and plays an essential role in neurite branching during sensory axon outgrowth. Knockdown of ULK1 results in impaired endocytosis of nerve growth factor (NGF), excessive axon arborization, and severely stunted axon elongation indicating that ULK1 mediates a non clathrin coated endocytosis in sensory growth cones. Knockdown of ULK1 also inhibits the autophagic response. It appears to act as a convergence point for multiple signals that regulate autophagy, and in turn interacts with a large number of autophagy related (Atg) proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
ATG13 [p Ser355]
Antibody
NBP2-19127
Western Blot ATG13 [p Ser355] Antibody
(19 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, KD, WB
Beclin 1 Antibody
- BSA Free
NB500-249
Western Blot Beclin 1 Antibody - BSA Free
Simple Western Beclin 1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Beclin 1 Antibody - BSA Free
(9 Reviews)
(163 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
ULK2 Antibody
NBP1-33136
Western Blot ULK2 Antibody
Immunocytochemistry/ Immunofluorescence ULK2 Antibody
Western Blot ULK2 Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RB1CC1 Antibody
NB100-77279
Western Blot RB1CC1 Antibody
Western Blot RB1CC1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IP, WB
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western Blot AMPK alpha 2 Antibody [Unconjugated]
Simple Western AMPK alpha 2 Antibody [Unconjugated]
Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
ROR
gamma/RORC/NR1F3 Anti ...
NBP2-24503
Immunohistochemistry-Paraffin ROR gamma/RORC/NR1F3 Antibody - BSA Free
Western Blot ROR gamma/RORC/NR1F3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence ROR gamma/RORC/NR1F3 Antibody - BSA Free
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
GATE-16/GABARAPL2
Antibody - BSA Free
NBP2-82090
Western Blot GATE-16/GABARAPL2 Antibody - BSA Free
Immunohistochemistry GATE-16/GABARAPL2 Antibody - BSA Free
Immunohistochemistry GATE-16/GABARAPL2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AMPK alpha 1
Antibody (2B7) - BSA
NBP2-22127
Flow Cytometry AMPK alpha 1 Antibody (2B7) - BSA Free
Flow Cytometry AMPK alpha 1 Antibody (2B7) - BSA Free
ELISA AMPK alpha 1 Antibody (2B7) - BSA Free
(12 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AMPK beta 1
Antibody [Unconjugate
AF2854
Western Blot AMPK beta 1 Antibody [Unconjugated]
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
ATG5 Antibody -
BSA Free
NB110-53818
Western Blot ATG5 Antibody - BSA Free
Immunohistochemistry ATG5 Antibody - BSA Free
Immunohistochemistry-Paraffin ATG5 Antibody - BSA Free
(7 Reviews)
(286 Publications)
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
GABARAPL1 Antibody
NBP1-55202
Immunohistochemistry-Paraffin GABARAPL1 Antibody
Western Blot GABARAPL1 Antibody
Western Blot GABARAPL1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
LC3A Antibody -
BSA Free
NB100-2331
Western Blot LC3A Antibody - BSA Free
Simple Western LC3A Antibody - BSA Free
Western Blot LC3A Antibody - BSA Free
(22 Reviews)
(306 Publications)
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
p62/SQSTM1
Antibody (2C11)
H00008878-M01
Immunocytochemistry/ Immunofluorescence p62/SQSTM1 Antibody (2C11)
Western Blot p62/SQSTM1 Antibody (2C11)
Western Blot p62/SQSTM1 Antibody (2C11)
(9 Reviews)
(413 Publications)
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
GTF2H1 Antibody
(1F12-1B5)
H00002965-M01
Western Blot GTF2H1 Antibody (1F12-1B5)
Immunocytochemistry/ Immunofluorescence GTF2H1 Antibody (1F12-1B5)
Immunohistochemistry-Paraffin GTF2H1 Antibody (1F12-1B5)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
ATG7 Antibody
(683906) [Unconjugate
MAB6608
Immunohistochemistry ATG7 Antibody (683906) [Unconjugated]
Simple Western ATG7 Antibody (683906) [Unconjugated]
Western Blot ATG7 Antibody (683906) [Unconjugated]
(1 Review)
(15 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NUP62 Antibody
NBP1-31381
Western Blot NUP62 Antibody
Immunocytochemistry/ Immunofluorescence NUP62 Antibody
Western Blot NUP62 Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
dynactin 4
Antibody (3G9D7) - BS
NBP2-37399
ELISA dynactin 4 Antibody (3G9D7) - BSA Free
Western Blot dynactin 4 Antibody (3G9D7) - BSA Free
Western Blot dynactin 4 Antibody (3G9D7) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
IMP2/IGF2BP2
Antibody (OTI3F9)
NBP2-02627
Flow Cytometry IMP2/IGF2BP2 Antibody (OTI3F9)
Flow Cytometry IMP2/IGF2BP2 Antibody (OTI3F9)
Western Blot IMP2/IGF2BP2 Antibody (OTI3F9)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ULK1 Recombinant
Protein Antigen
NBP2-56576PEP
ULK1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ULK1 Recombinant Protein Antigen (NBP2-56576PEP) (0)

There are no publications for ULK1 Recombinant Protein Antigen (NBP2-56576PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ULK1 Recombinant Protein Antigen (NBP2-56576PEP) (0)

There are no reviews for ULK1 Recombinant Protein Antigen (NBP2-56576PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ULK1 Recombinant Protein Antigen (NBP2-56576PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ULK1 Products

Research Areas for ULK1 Recombinant Protein Antigen (NBP2-56576PEP)

Find related products by research area.

Blogs on ULK1.

Check out the latest blog posts on ULK1.
Autophagy Research Update: What a difference a year makes!
By Christina Towers, PhD Over the last two decades the field of autophagy has exploded! Innovative techniques, comprehensive analysis and disease-relevant models have yielded basic and clinical discoveries of conseque...  Read full blog post.
Animal Models to Study Autophagy
By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the...  Read full blog post.

  Read full blog post.

  Read full blog post.
Autophagy independent roles of the core ATG proteins
By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation.  It is critical for removal of dam...  Read full blog post.
The Many Connections Between Autophagy and Kidney Disease
By Yoskaly Lazo-Fernandez, PhD The first description of what is called today an autophagosome was given in a paper published in 1957. Its author employed electron microscopy to observe the neonatal features of mous...  Read full blog post.
VPS34 - autophagy initiator and regulator of endosomal trafficking
VPS34, vacuolar protein sorting 34, is the only identified Class III phosphoinositide-3 kinase (PI3K) in mammals and is ubiquitously expressed in all eukaryotic cells. VPS34 is a 100 kDa protein responsible for phosphorylating phosphatidylinositol...  Read full blog post.
ULK1 - mammalian homologue of the yeast ATG1 kinase
Autophagy is an important cellular process involved in degradation and recycling of cellular macromolecules in response to stress or starvation. Autophagy is carried out in four main phases: phagophore nucleation, autophagosome elongation, docking...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - Analysis of p62 in SH-SY5Y cells using anti-p62/SQSTM1 antibody. Red - p62 puncta; Blue - nuclear DAPI; Green - Cytoskeleton. Image from verified customer review.
p62/SQSTM1 Antibody (2C11)
H00008878-M01
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - Autophagy mobilized during differentiation of immortalized human mesenchymal stem cells (ihMSCs). Cultured ihMSCs were stimulated to undergo osteogenesis to form osteoblasts for 30 days at 21% and 4% oxygen. LC3I and LC3II levels were assessed via immunoblot every 10 days and normalized to beta-actin to derive average LC3II band densities. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25523618/) licensed under a CC-BY license.
LC3A Antibody - BSA Free
NB100-2331
Western Blot: ATG5 Antibody - BSA Free [NB110-53818] - Representative Western blot images and quantitative analyses of ATG5 from the left hemisphere of rat brains at different time points after SAH. Sample size is 36, n = 6 per group. Data were presented as mean +/- SD. F = 22.14 for ATG5. *P < .05, ** P < .01, ***P < .001 vs Sham group. SAH, subarachnoid hemorrhage; Vehicle, phosphate-buffered saline; rOPN, recombinant OPN. NS, not significant. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31436915/) licensed under a CC-BY license.
ATG5 Antibody - BSA Free
NB110-53818

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ULK1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ULK1