Home » UBAP1 » UBAP1 Proteins » UBAP1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

UBAP1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for UBAP1 Protein (NBP1-80651PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

UBAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBAP1.

Source: E. coli

Amino Acid Sequence: FHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLEKKTIEWAEEIKKIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UBAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80651.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UBAP1 Recombinant Protein Antigen

  • MGC119669
  • MGC8710
  • NAG20
  • Nasopharyngeal carcinoma-associated gene 20 protein
  • UAP
  • UBAP
  • UBAP-1
  • ubiquitin associated protein 1
  • ubiquitin associated protein
  • ubiquitin-associated protein 1

Background

UBAP1 is a member of the UBA domain family, whose members include proteins having connections to ubiquitin and the ubiquitination pathway. The ubiquitin associated domain is thought to be a non-covalent ubiquitin binding domain consisting of a compact three helix bundle. This particular protein originates from a gene locus in a refined region on chromosome 9 undergoing loss of heterozygosity in nasopharyngeal carcinoma (NPC). Taking into account its cytogenetic location, this UBA domain family member is being studies as a putative target for mutation in nasopharyngeal carcinomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
BST2 Antibody
(120G8.04)
DDX0390P-100
Immunocytochemistry/ Immunofluorescence BST2 Antibody (120G8.04)
Immunohistochemistry BST2 Antibody (120G8.04)
Flow Cytometry BST2 Antibody (120G8.04)
(64 Publications)
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vivo
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(66 Publications)
Species: Hu
Applications: ELISA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(631 Publications)
Species: Mu
Applications: ELISA
TSG101 Antibody
(4A10)
NB200-112
Western Blot TSG101 Antibody (4A10)
Flow Cytometry TSG101 Antibody (4A10)
Flow Cytometry TSG101 Antibody (4A10)
(2 Reviews)
(97 Publications)
Species: Ca, Ha, Hu, Pm, Mu, Po, Pm, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, IP, KD, WB
Pentraxin 2/SAP
Antibody [Unconjugate
AF2558
Western Blot Pentraxin 2/SAP Antibody [Unconjugated]
Simple Western Pentraxin 2/SAP Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu
Applications: Simple Western, WB
SH2D1A Antibody
(1C9)
H00004068-M01
Western Blot SH2D1A Antibody (1C9)
Flow Cytometry SH2D1A Antibody (1C9)
ELISA SH2D1A Antibody (1C9)
(1 Review)
(9 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
LYPLA3 Antibody
NBP1-92089
Immunohistochemistry-Paraffin LYPLA3 Antibody
Immunohistochemistry-Paraffin LYPLA3 Antibody
Immunohistochemistry-Paraffin LYPLA3 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
NGX6 Antibody
NBP1-60075
Western Blot NGX6 Antibody
Immunohistochemistry-Paraffin NGX6 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
VPS28 Antibody
(OTI1A8)
NBP2-45412
Immunofluorescence VPS28 Antibody (OTI1A8)
Immunohistochemistry VPS28 Antibody (OTI1A8)
Western Blot VPS28 Antibody (OTI1A8)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, WB
Acetyl CoA
synthetase Antibody
NBP1-90276
Immunohistochemistry-Paraffin Acetyl CoA synthetase Antibody
Immunohistochemistry-Paraffin Acetyl CoA synthetase Antibody
Immunohistochemistry-Paraffin Acetyl CoA synthetase Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PLUNC Antibody
AF4274
Western Blot PLUNC Antibody
Immunohistochemistry PLUNC Antibody
Western Blot PLUNC Antibody
(5 Publications)
Species: Mu
Applications: IHC, WB
Integrin alpha
2/CD49b Antibody (HAS ...
MAB1233
Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]
Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
PHACS Antibody
NBP1-90260
Western Blot PHACS Antibody
Immunohistochemistry-Paraffin PHACS Antibody
Immunocytochemistry/ Immunofluorescence PHACS Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(44 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Niemann-Pick C1
Antibody - BSA Free
NB400-148
Immunocytochemistry/ Immunofluorescence Niemann-Pick C1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Niemann-Pick C1 Antibody - BSA Free
Immunohistochemistry-Paraffin Niemann-Pick C1 Antibody - BSA Free
(6 Reviews)
(53 Publications)
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Aminopeptidase
N/CD13 Antibody [Unco ...
AF2335
Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
(53 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA

Publications for UBAP1 Protein (NBP1-80651PEP) (0)

There are no publications for UBAP1 Protein (NBP1-80651PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBAP1 Protein (NBP1-80651PEP) (0)

There are no reviews for UBAP1 Protein (NBP1-80651PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UBAP1 Protein (NBP1-80651PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UBAP1 Products

Blogs on UBAP1.

Check out the latest blog posts on UBAP1.
Chinese Cancer Study Reveals Three New Genes for Nasopharyngeal Carcinomas
A large percentage of the products in our antibody catalog are used for cancer research. Some oncogenes are expressed in several types of tumor, while others are quite specific. For example, there are several products on our antibody database which ta...  Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunocytochemistry/Immunofluorescence: UBAP1 Antibody [NBP1-80651] - Staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus.
UBAP1 Antibody
NBP1-80651

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UBAP1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol UBAP1