Novus Biologicals products are now on bio-techne.com

TRIM3/BERP Recombinant Protein Antigen

Name: TRIM3/BERP Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-48791PEP
Price: 279 USD

Images

There are currently no images for TRIM3/BERP Recombinant Protein Antigen (NBP2-48791PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TRIM3/BERP Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM3/BERP. Source: E. coli Amino Acid Sequence: TQRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHETVAT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	TRIM3
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48791. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRIM3/BERP Recombinant Protein Antigen

BERPRING finger protein 97
Brain-expressed RING finger protein
HAC1
RING finger protein 22
RNF22brain expressed ring finger
RNF97FLJ16135
tripartite motif containing 3
tripartite motif protein TRIM3
tripartite motif-containing 3
tripartite motif-containing protein 3

Background

TRIM3 is encoded by this gene is a member of the tripartite motif (TRIM) family, also called the 'RING-B-box-coiled-coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic filaments. It is similar to a rat protein which is a specific partner for the tail domain of myosin V, a class of myosins which are involved in the targeted transport of organelles. The rat protein can also interact with alpha-actinin-4. Thus it is suggested that this human protein may play a role in myosin V-mediated cargo transport. Alternatively spliced transcript variants encoding the same isoform have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IRE1 alpha [p
Ser724] Antibody - BS ...

NB100-2323

Western Blot IRE1 alpha [p Ser724] Antibody - BSA Free

(9 Reviews)

(335 Publications)

Species: Dr, Gt, SyHa, Hu, Ma, Pm, Mu, Po, Pm, Rb, Rt

Applications: ChIP, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, Simple Western, WB

XBP1 Antibody -
BSA Free

NBP1-77681

(18 Publications)

Species: Hu, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB

ATF6 Antibody
(70B1413.1) - BSA Fre

NBP1-40256

Flow (Intracellular) ATF6 Antibody (70B1413.1) - BSA Free

Immunohistochemistry-Paraffin ATF6 Antibody (70B1413.1) - BSA Free

(3 Reviews)

(246 Publications)

Species: Hu, Mu, Pl, Po, Rb, Rt

Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB

PADI1 Antibody

NBP2-37761

Species: Hu

Applications: ICC/IF, IHC, IHC-P

GRP78/HSPA5
Antibody - BSA Free

NBP1-06274

Immunocytochemistry/ Immunofluorescence GRP78/HSPA5 Antibody - BSA Free

(2 Reviews)

(43 Publications)

Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze

Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB

Alpha Actinin 4
Antibody (4D10)

H00000081-M01

Western Blot Alpha Actinin 4 Antibody (4D10)

Immunocytochemistry/ Immunofluorescence Alpha Actinin 4 Antibody (4D10)

(4 Publications)

Species: Hu, Pm, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

HGS Antibody (6D11)

H00009146-M01

(2 Publications)

Species: Hu, Mu

Applications: ELISA, Flow, ICC/IF, KD, S-ELISA, WB

Myosin 5a Antibody

NBP1-92156

Immunohistochemistry-Paraffin Myosin 5a Antibody

(9 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, KD

EGFR Antibody
[Unconjugated]

AF231

Immunocytochemistry EGFR Antibody [Unconjugated]

Western Blot EGFR Antibody [Unconjugated]

(30 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB

BMP-3b/GDF-10
Antibody [Unconjugate

AF1543

(1 Publication)

Species: Hu

Applications: IHC, WB

ERN2 Antibody

NBP3-17487

Species: Hu

Applications: IHC, IHC-P

ISYNA1 Antibody

NBP2-47415

Immunohistochemistry-Paraffin ISYNA1 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

GADD153/CHOP
Antibody (9C8)

NB600-1335

Flow Cytometry GADD153/CHOP Antibody (9C8)

Immunohistochemistry-Paraffin GADD153/CHOP Antibody (9C8)

(3 Reviews)

(46 Publications)

Species: Hu, Mu, Pm, Rt

Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB

TRIM17 Antibody
(2E11)

H00051127-M01

Immunocytochemistry/ Immunofluorescence TRIM17 Antibody (2E11)

(2 Publications)

Species: Hu

Applications: ELISA, ICC/IF, PLA, S-ELISA, WB

BIK Antibody

NB100-56109

(2 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, IP, WB

SFRS5 Antibody

H00006430-B01P

Immunocytochemistry/ Immunofluorescence SFRS5 Antibody

Immunohistochemistry-Paraffin SFRS5 Antibody

(1 Review)

(2 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

FE65 Antibody -
BSA Free

NB110-58360

Species: Hu, Mu, Rt

Applications: IP, WB

GKAP/DLGAP1
Antibody - BSA Free

NBP1-76911

Immunohistochemistry GKAP/DLGAP1 Antibody - BSA Free

(1 Publication)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

beta-Galactosidase-1/G ...

NBP2-45731

Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)

(6 Publications)

Species: Ca, Hu, Pm

Applications: IHC, IHC-P, WB

TRIM3/BERP
Recombinant Protein A

NBP2-48791PEP

Species: Hu

Applications: AC

Publications for TRIM3/BERP Recombinant Protein Antigen (NBP2-48791PEP) (0)

There are no publications for TRIM3/BERP Recombinant Protein Antigen (NBP2-48791PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM3/BERP Recombinant Protein Antigen (NBP2-48791PEP) (0)

There are no reviews for TRIM3/BERP Recombinant Protein Antigen (NBP2-48791PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRIM3/BERP Recombinant Protein Antigen (NBP2-48791PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM3/BERP Products

Blogs on TRIM3/BERP

There are no specific blogs for TRIM3/BERP, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

IRE1 (pS724) was detected in immersion fixed paraffin-embedded sections of human spleen using Rabbit Anti-Human IRE1 (pS724) polyclonal Antibody (Catalog # NB100-2323) at 1:300 for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the perinuclear cytoplasm in splenocytes.

IRE1 alpha [p Ser724] Antibody - BSA Free
NB100-2323

Western Blot: ATF6 Antibody (70B1413.1) [NBP1-40256] - Hypoxia leads to EMT and ER-stress in CRC cells. B. C. Confluent growing SW480 (B) and HCT116 (C) cells were cultured under conditions of normoxia or hypoxia-like conditions (serum free; 100 uM CoCl2, 1-9 h. B-actin (B-act) as loading control. HIF1a was detectable after 3 h of CoCl2 incubation, the amount of the 50 kD-ATF6 fragment, was already enhanced after 1 h of addition of CoCl2. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0087386) licensed under a CC-BY license.

ATF6 Antibody (70B1413.1) - BSA Free
NBP1-40256-0.1mg

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our TRIM3/BERP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

TRIM3

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

TRIM3/BERP Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

TRIM3/BERP Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for TRIM3/BERP Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for TRIM3/BERP Recombinant Protein Antigen (NBP2-48791PEP) (0)

Reviews for TRIM3/BERP Recombinant Protein Antigen (NBP2-48791PEP) (0)

FAQs for TRIM3/BERP Recombinant Protein Antigen (NBP2-48791PEP) (0)

Additional TRIM3/BERP Products

Blogs on TRIM3/BERP

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics