![Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Analysis in human cerebral cortex and liver tissues. Corresponding Myosin 5a RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Myosin-5a-Antibody-Immunohistochemistry-Paraffin-NBP1-92156-img0011.jpg "Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Analysis in human cerebral cortex and liver tissues. Corresponding Myosin 5a RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPG |
| Predicted Species | Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYO5A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-P Retrieval method: HIER pH6, ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Myosin 5a Antibody (NBP1-92156)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYO5A |
![Immunocytochemistry/Immunofluorescence: Myosin 5a Antibody [NBP1-92156] - Staining of human cell line A-431 shows localization to microtubule organizing center & focal adhesion sites. Antibody staining shown in green.](http://images.novusbio.com/fullsize/Myosin-5a-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92156-img0005.jpg "Immunocytochemistry/Immunofluorescence: Myosin 5a Antibody [NBP1-92156] - Staining of human cell line A-431 shows localization to microtubule organizing center & focal adhesion sites. Antibody staining shown in green.")
![Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human kIdney shows moderate memberanous positivity in cells in tubules.](http://images.novusbio.com/fullsize/Myosin-5a-Antibody-Immunohistochemistry-Paraffin-NBP1-92156-img0013.jpg "Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human kIdney shows moderate memberanous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/Myosin-5a-Antibody-Immunohistochemistry-Paraffin-NBP1-92156-img0002.jpg "Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human cerebral cortex shows strong membranous positivity in neuropil.](http://images.novusbio.com/fullsize/Myosin-5a-Antibody-Immunohistochemistry-Paraffin-NBP1-92156-img0006.jpg "Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human cerebral cortex shows strong membranous positivity in neuropil.")
![Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human hippocampus shows strong cytoplasmic positivity in pyramidal cells.](http://images.novusbio.com/fullsize/Myosin-5a-Antibody-Immunohistochemistry-Paraffin-NBP1-92156-img0009.jpg "Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human hippocampus shows strong cytoplasmic positivity in pyramidal cells.")
![Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human kidney shows moderate membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/Myosin-5a-Antibody-Immunohistochemistry-Paraffin-NBP1-92156-img0012.jpg "Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human kidney shows moderate membranous positivity in cells in tubules.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![PIN/DLC8 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PIN/DLC8 Antibody [Unconjugated]")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")