![Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining in human esophagus and colon tissues using anti-PADI1 antibody. Corresponding PADI1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PADI1-Antibody-Immunohistochemistry-Paraffin-NBP2-37761-img0004.jpg "Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining in human esophagus and colon tissues using anti-PADI1 antibody. Corresponding PADI1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: PSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PADI1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PADI1 Antibody (NBP2-37761)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PADI1 |
![Immunocytochemistry/Immunofluorescence: PADI1 Antibody [NBP2-37761] - Staining of human cell line HaCaT shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PADI1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37761-img0002.jpg "Immunocytochemistry/Immunofluorescence: PADI1 Antibody [NBP2-37761] - Staining of human cell line HaCaT shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human colon shows low expression as expected.](http://images.novusbio.com/fullsize/PADI1-Antibody-Immunohistochemistry-Paraffin-NBP2-37761-img0003.jpg "Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human colon shows low expression as expected.")
![Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/PADI1-Antibody-Immunohistochemistry-NBP2-37761-img0001.jpg "Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry BMP-3b/GDF-10 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1543_human-bmp-3b-gdf-10-affinity-purified-polyclonal-ab-immunocytochemistry-133202414504.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")