![Immunocytochemistry/Immunofluorescence: TRIM2 Antibody [NBP1-81504] - Staining of human cell line U-251 MG shows localization to centrosome. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TRIM2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81504-img0010.jpg "Immunocytochemistry/Immunofluorescence: TRIM2 Antibody [NBP1-81504] - Staining of human cell line U-251 MG shows localization to centrosome. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHK |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRIM2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western Blot reported in scientific literature (PMID:30916596). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-81504 | Applications | Species |
|---|---|---|
| Cao, H;Fang, Y;Liang, Q;Wang, J;Luo, B;Zeng, G;Zhang, T;Jing, X;Wang, X; TRIM2 is a novel promoter of human colorectal cancer Scand. J. Gastroenterol. 2019-03-27 [PMID: 30916596] (WB, IHC-P, Human) | WB, IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TRIM2 |
![Immunohistochemistry-Paraffin: TRIM2 Antibody [NBP1-81504] - Staining in human cerebral cortex and lymph node tissues using anti-TRIM2 antibody. Corresponding TRIM2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TRIM2-Antibody-Immunohistochemistry-Paraffin-NBP1-81504-img0009.jpg "Immunohistochemistry-Paraffin: TRIM2 Antibody [NBP1-81504] - Staining in human cerebral cortex and lymph node tissues using anti-TRIM2 antibody. Corresponding TRIM2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: TRIM2 Antibody [NBP1-81504] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/TRIM2-Antibody-Immunohistochemistry-Paraffin-NBP1-81504-img0007.jpg "Immunohistochemistry-Paraffin: TRIM2 Antibody [NBP1-81504] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: TRIM2 Antibody [NBP1-81504] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/TRIM2-Antibody-Immunohistochemistry-Paraffin-NBP1-81504-img0008.jpg "Immunohistochemistry-Paraffin: TRIM2 Antibody [NBP1-81504] - Staining of human lymph node shows low expression as expected.")
![Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Immunocytochemistry__Immunofluorescence_21057.jpg)
![Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Simple_Western_16621.jpg)
![Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Western_Blot_12767.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")