![Immunohistochemistry: TMEM103 Antibody [NBP1-91733] - Low expression levels of ELP6 was highly associated with poor overall survivals in GBC patients. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-019-13420-x) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TMEM103-Antibody-Immunohistochemistry-NBP1-91733-img0005.jpg "Immunohistochemistry: TMEM103 Antibody [NBP1-91733] - Low expression levels of ELP6 was highly associated with poor overall survivals in GBC patients. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-019-13420-x) licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ELP6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
| Publication using NBP1-91733 | Applications | Species |
|---|---|---|
| Xu S, Zhan M, Jiang C Genome-wide CRISPR screen identifies ELP5 as a determinant of gemcitabine sensitivity in gallbladder cancer Nat Commun 2019-12-02 [PMID: 31792210] (WB, IF/IHC, Human) | WB, IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ELP6 |
![Western Blot: TMEM103 Antibody [NBP1-91733] - The integrity and stability of the Elongator complex are required for gemcitabine-induced cytotoxic effects in GBC cells. a ELP5 depletion significantly downregulated the protein levels of other Elongator subunits, including ELP1, ELP2, ELP3, ELP4, ELP6. b ELP5 depletion significantly decreased ATPase activity in NOZ cells. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-019-13420-x) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TMEM103-Antibody-Western-Blot-NBP1-91733-img0006.jpg "Western Blot: TMEM103 Antibody [NBP1-91733] - The integrity and stability of the Elongator complex are required for gemcitabine-induced cytotoxic effects in GBC cells. a ELP5 depletion significantly downregulated the protein levels of other Elongator subunits, including ELP1, ELP2, ELP3, ELP4, ELP6. b ELP5 depletion significantly decreased ATPase activity in NOZ cells. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-019-13420-x) licensed under a CC-BY license.")
![Western Blot: C3orf75/ELP6 Antibody [NBP1-91733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/C3orf75-ELP6-Antibody-Western-Blot-NBP1-91733-img0004.jpg "Western Blot: C3orf75/ELP6 Antibody [NBP1-91733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunohistochemistry-Paraffin: C3orf75/ELP6 Antibody [NBP1-91733] - Staining of human pancreas shows distinct granular cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/C3orf75-ELP6-Antibody-Immunohistochemistry-Paraffin-NBP1-91733-img0002.jpg "Immunohistochemistry-Paraffin: C3orf75/ELP6 Antibody [NBP1-91733] - Staining of human pancreas shows distinct granular cytoplasmic positivity in exocrine glandular cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")