![Immunohistochemistry: TMEM103 Antibody [NBP1-91733] - Low expression levels of ELP6 was highly associated with poor overall survivals in GBC patients. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-019-13420-x) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TMEM103-Antibody-Immunohistochemistry-NBP1-91733-img0005.jpg "Immunohistochemistry: TMEM103 Antibody [NBP1-91733] - Low expression levels of ELP6 was highly associated with poor overall survivals in GBC patients. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-019-13420-x) licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ELP6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
| Publication using NBP1-91733 | Applications | Species |
|---|---|---|
| Xu S, Zhan M, Jiang C Genome-wide CRISPR screen identifies ELP5 as a determinant of gemcitabine sensitivity in gallbladder cancer Nat Commun 2019-12-02 [PMID: 31792210] (WB, IF/IHC, Human) | WB, IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ELP6 |
![Western Blot: TMEM103 Antibody [NBP1-91733] - The integrity and stability of the Elongator complex are required for gemcitabine-induced cytotoxic effects in GBC cells. a ELP5 depletion significantly downregulated the protein levels of other Elongator subunits, including ELP1, ELP2, ELP3, ELP4, ELP6. b ELP5 depletion significantly decreased ATPase activity in NOZ cells. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-019-13420-x) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TMEM103-Antibody-Western-Blot-NBP1-91733-img0006.jpg "Western Blot: TMEM103 Antibody [NBP1-91733] - The integrity and stability of the Elongator complex are required for gemcitabine-induced cytotoxic effects in GBC cells. a ELP5 depletion significantly downregulated the protein levels of other Elongator subunits, including ELP1, ELP2, ELP3, ELP4, ELP6. b ELP5 depletion significantly decreased ATPase activity in NOZ cells. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-019-13420-x) licensed under a CC-BY license.")
![Western Blot: C3orf75/ELP6 Antibody [NBP1-91733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/C3orf75-ELP6-Antibody-Western-Blot-NBP1-91733-img0004.jpg "Western Blot: C3orf75/ELP6 Antibody [NBP1-91733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunohistochemistry-Paraffin: C3orf75/ELP6 Antibody [NBP1-91733] - Staining of human pancreas shows distinct granular cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/C3orf75-ELP6-Antibody-Immunohistochemistry-Paraffin-NBP1-91733-img0002.jpg "Immunohistochemistry-Paraffin: C3orf75/ELP6 Antibody [NBP1-91733] - Staining of human pancreas shows distinct granular cytoplasmic positivity in exocrine glandular cells.")
![Western Blot: TMEM103 Antibody [NBP1-91733] - The integrity & stability of the Elongator complex are required for gemcitabine-induced cytotoxic effects in GBC cells. a ELP5 depletion significantly downregulated the protein levels of other Elongator subunits, including ELP1, ELP2, ELP3, ELP4, ELP6. b ELP5 depletion significantly decreased ATPase activity in NOZ cells. c The abundance of thiolated tEUUC tRNA was decreased in ELP5-depleted NOZ cells. d Ectopically expressed ELP5 could interact with ELP3 & ELP4 in GBC cells. e Endogenous ELP3 & ELP4 degraded rapidly after treatment with 50 µg ml−1 cycloheximide (CHX) in ELP5-depleted GBC cells compared with WT cells. f–h Ectopically expressed ELP5 (f) could promote or rescue thiolated tRNA abundance (g) & GEM sensitivity (h) in WT & ELP5-depleted GBC cells, but ectopically expressed ELP3 or ELP4 (f) could only increase the abundance of thiolated tRNA (g) & GEM sensitivity (h) in WT cells, not in ELP5-depleted cells. i, j Mutation of the ATPase activity site residue within ELP5 (D124A) (i) could not promote GEM sensitivity in GBC cells (j). k, l Mutation of the cm5U catalytic activity site residue with ELP3 (C109/112 S) (k) could not promote GEM sensitivity in GBC cells (l). Data represent the mean ± S.D., n = 3 independent experiments in b, h, j, l, error bars represent S.D. Unpaired Student’s t-tests were used in b, h (NS, non-significant, **P < 0.01 & ***P < 0.001). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31792210), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-91733_rabbit-polyclonal-tmem103-antibody-310202416121999.jpg "Western Blot: TMEM103 Antibody [NBP1-91733] - The integrity & stability of the Elongator complex are required for gemcitabine-induced cytotoxic effects in GBC cells. a ELP5 depletion significantly downregulated the protein levels of other Elongator subunits, including ELP1, ELP2, ELP3, ELP4, ELP6. b ELP5 depletion significantly decreased ATPase activity in NOZ cells. c The abundance of thiolated tEUUC tRNA was decreased in ELP5-depleted NOZ cells. d Ectopically expressed ELP5 could interact with ELP3 & ELP4 in GBC cells. e Endogenous ELP3 & ELP4 degraded rapidly after treatment with 50 µg ml−1 cycloheximide (CHX) in ELP5-depleted GBC cells compared with WT cells. f–h Ectopically expressed ELP5 (f) could promote or rescue thiolated tRNA abundance (g) & GEM sensitivity (h) in WT & ELP5-depleted GBC cells, but ectopically expressed ELP3 or ELP4 (f) could only increase the abundance of thiolated tRNA (g) & GEM sensitivity (h) in WT cells, not in ELP5-depleted cells. i, j Mutation of the ATPase activity site residue within ELP5 (D124A) (i) could not promote GEM sensitivity in GBC cells (j). k, l Mutation of the cm5U catalytic activity site residue with ELP3 (C109/112 S) (k) could not promote GEM sensitivity in GBC cells (l). Data represent the mean ± S.D., n = 3 independent experiments in b, h, j, l, error bars represent S.D. Unpaired Student’s t-tests were used in b, h (NS, non-significant, **P < 0.01 & ***P < 0.001). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31792210), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")