![Western Blot: TIMM44 Antibody [H00010469-B01P] - Analysis of TIMM44 expression in transfected 293T cell line by TIMM44 polyclonal antibody. Lane 1: TIMM44 transfected lysate(49.72 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/TIMM44-Antibody-Western-Blot-H00010469-B01P-img0002.jpg "Western Blot: TIMM44 Antibody [H00010469-B01P] - Analysis of TIMM44 expression in transfected 293T cell line by TIMM44 polyclonal antibody. Lane 1: TIMM44 transfected lysate(49.72 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | TIMM44 (NP_006342.2, 1 a.a. - 452 a.a.) full-length human protein. MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKSYSSGNRKGFLSGLLDNVKQELAKNKEMKESIKKFRDEARRLEESDVLQEARRKYKTIESETVRTSEVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | TIMM44 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is useful for Western Blot, Functional |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TIMM44 Antibody (H00010469-B01P)Find related products by research area.
|
|
New Players in the Mitophagy Game By Christina Towers, PhD Mitochondrial turn over via the lysosome, otherwise known as mitophagy, involves engulfment of mitochondria into double membrane autophagosomes and subsequent fusion with lysosomes. Much is al... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TIMM44 |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: TIMM44 Antibody [H00010469-B01P] - Analysis of purified antibody to TIMM44 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/TIMM44-Antibody-Immunocytochemistry-Immunofluorescence-H00010469-B01P-img0001.jpg "Immunocytochemistry/Immunofluorescence: TIMM44 Antibody [H00010469-B01P] - Analysis of purified antibody to TIMM44 on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]](https://images.novusbio.com/images2/TIM1_AF1817_Western_Blot_17317.jpg)
![Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]](https://images.novusbio.com/images/af1817_mouse-tim-1-kim-1-havcr-affinity-purified-polyclonal-ab-4120241049450.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")