Thrombospondin-3 Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 787-956 of human THBS3 (NP_009043.1). TDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSGPGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQLVADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
THBS3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Thrombospondin-3 Antibody - BSA Free
Background
THBS3 is a gene that codes for an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions and has two isoforms, with lengths of 956 and 836 amino acids and weights of approximately 104 and 91 kDa respectively. Current research is being done on diseases and disorders related to this gene including osteosarcoma, lung cancer, breast cancer, retinitis, malaria, neuronitis, and echinococcosis. THBS3 has also been shown to have interactions with THBS2, THBS1, THBS4, FURIN, and PDGFB in pathways such as the focal adhesion, inflammatory response, signal transduction, signaling by PDGF, phagosome, ECM-receptor interaction, and malaria pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Eq, Gt, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC, KO, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IP, WB
Species: Mu, Rt
Applications: WB
Publications for Thrombospondin-3 Antibody (NBP2-94865) (0)
There are no publications for Thrombospondin-3 Antibody (NBP2-94865).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Thrombospondin-3 Antibody (NBP2-94865) (0)
There are no reviews for Thrombospondin-3 Antibody (NBP2-94865).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Thrombospondin-3 Antibody (NBP2-94865) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Thrombospondin-3 Products
Research Areas for Thrombospondin-3 Antibody (NBP2-94865)
Find related products by research area.
|
Blogs on Thrombospondin-3