![Western Blot: Testin Antibody [NBP1-85072] - Analysis using Anti-TES antibody NBP1-85072 (A) shows similar pattern to independent antibody NBP1-87987 (B).](http://images.novusbio.com/fullsize/Testin-Antibody-Western-Blot-NBP1-85072-img0010.jpg "Western Blot: Testin Antibody [NBP1-85072] - Analysis using Anti-TES antibody NBP1-85072 (A) shows similar pattern to independent antibody NBP1-87987 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKK |
| Predicted Species | Mouse (97%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TES |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Testin Antibody (NBP1-85072)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TES |
![Immunocytochemistry/Immunofluorescence: Testin Antibody [NBP1-85072] - Staining of human cell line SiHa shows localization to plasma membrane, cytosol & focal adhesion sites. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Testin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85072-img0008.jpg "Immunocytochemistry/Immunofluorescence: Testin Antibody [NBP1-85072] - Staining of human cell line SiHa shows localization to plasma membrane, cytosol & focal adhesion sites. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Testin Antibody [NBP1-85072] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Testin-Antibody-Immunohistochemistry-Paraffin-NBP1-85072-img0015.jpg "Immunohistochemistry-Paraffin: Testin Antibody [NBP1-85072] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: Testin Antibody [NBP1-85072] - Western blot analysis in human cell lines A-431 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.](http://images.novusbio.com/fullsize/Testin-Antibody-Western-Blot-NBP1-85072-img0009.jpg "Western Blot: Testin Antibody [NBP1-85072] - Western blot analysis in human cell lines A-431 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.")
![Immunohistochemistry-Paraffin: Testin Antibody [NBP1-85072] - Staining of human endometrium, liver, testis and urinary bladder using Anti-TES antibody NBP1-85072 (A) shows similar protein distribution across tissues to independent antibody NBP1-87987 (B).](http://images.novusbio.com/fullsize/Testin-Antibody-Immunohistochemistry-Paraffin-NBP1-85072-img0011.jpg "Immunohistochemistry-Paraffin: Testin Antibody [NBP1-85072] - Staining of human endometrium, liver, testis and urinary bladder using Anti-TES antibody NBP1-85072 (A) shows similar protein distribution across tissues to independent antibody NBP1-87987 (B).")
![Immunohistochemistry-Paraffin: Testin Antibody [NBP1-85072] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Testin-Antibody-Immunohistochemistry-Paraffin-NBP1-85072-img0012.jpg "Immunohistochemistry-Paraffin: Testin Antibody [NBP1-85072] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Testin Antibody [NBP1-85072] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://images.novusbio.com/fullsize/Testin-Antibody-Immunohistochemistry-Paraffin-NBP1-85072-img0013.jpg "Immunohistochemistry-Paraffin: Testin Antibody [NBP1-85072] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.")
![Immunohistochemistry-Paraffin: Testin Antibody [NBP1-85072] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Testin-Antibody-Immunohistochemistry-Paraffin-NBP1-85072-img0014.jpg "Immunohistochemistry-Paraffin: Testin Antibody [NBP1-85072] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Western_Blot_20998.jpg)
![Immunohistochemistry Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Immunohistochemistry_17794.jpg)
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images/af952_human-cathepsin-l-affinity-purified-polyclonal-ab-8220249511428.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")