![Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - TCF19 monoclonal antibody (M01), clone 6D8 Analysis of TCF19 expression in Hela S3 NE.](http://images.novusbio.com/fullsize/TCF19-Antibody-6D8-Western-Blot-H00006941-M01-img0013.jpg "Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - TCF19 monoclonal antibody (M01), clone 6D8 Analysis of TCF19 expression in Hela S3 NE.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, KD |
| Clone | 6D8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | TCF19 (NP_009040, 17 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLYTFHPPAGVGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLL |
| Specificity | TCF19 - transcription factor 19 (SC1) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TCF19 |
| Purity | Ascites |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Ascites |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
![Immunohistochemistry ALCAM/CD166 Antibody [Unconjugated]](https://images.novusbio.com/images2/ALCAM_AF1172_Immunohistochemistry_7112.jpg)
![Immunocytochemistry ALCAM/CD166 Antibody [Unconjugated]](https://images.novusbio.com/images2/ALCAM_AF1172_Immunocytochemistry_12727.jpg)
![Western Blot ALCAM/CD166 Antibody [Unconjugated]](https://images.novusbio.com/images2/ALCAM_AF1172_Western_Blot_19223.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TCF19 Antibody (H00006941-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/TCF19-Antibody-6D8-Immunocytochemistry-Immunofluorescence-H00006941-M01-img0008.jpg "Immunocytochemistry/Immunofluorescence: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/TCF19-Antibody-6D8-Immunohistochemistry-Paraffin-H00006941-M01-img0010.jpg "Immunohistochemistry-Paraffin: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.")
![Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of TCF19 over-expressed 293 cell line, cotransfected with TCF19 Validated Chimera RNAi ( Cat # H00006941-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF19 monoclonal antibody (M01), clone 6D8 (Cat # H00006941-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/TCF19-Antibody-6D8-Western-Blot-H00006941-M01-img0011.jpg "Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of TCF19 over-expressed 293 cell line, cotransfected with TCF19 Validated Chimera RNAi ( Cat # H00006941-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF19 monoclonal antibody (M01), clone 6D8 (Cat # H00006941-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of TCF19 expression in transfected 293T cell line by TCF19 monoclonal antibody (M01), clone 6D8.Lane 1: TCF19 transfected lysate(37.2 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/TCF19-Antibody-6D8-Western-Blot-H00006941-M01-img0014.jpg "Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of TCF19 expression in transfected 293T cell line by TCF19 monoclonal antibody (M01), clone 6D8.Lane 1: TCF19 transfected lysate(37.2 KDa).Lane 2: Non-transfected lysate.")
![ELISA: TCF19 Antibody (6D8) [H00006941-M01] - Detection limit for recombinant GST tagged TCF19 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/TCF19-Antibody-6D8-ELISA-H00006941-M01-img0015.jpg "ELISA: TCF19 Antibody (6D8) [H00006941-M01] - Detection limit for recombinant GST tagged TCF19 is approximately 0.1ng/ml as a capture antibody.")
![Western Blot SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Western_Blot_20730.jpg)
![Immunohistochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunohistochemistry_10419.jpg)
![Immunocytochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunocytochemistry__Immunofluorescence_23321.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")