![Western Blot: Syntaxin 12 Antibody (3B9) [H00023673-M01] - Analysis of STX12 expression in transfected 293T cell line by STX12 monoclonal antibody (M01), clone 3B9.Lane 1: STX12 transfected lysate(31.6 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Syntaxin-12-Antibody-3B9-Western-Blot-H00023673-M01-img0003.jpg "Western Blot: Syntaxin 12 Antibody (3B9) [H00023673-M01] - Analysis of STX12 expression in transfected 293T cell line by STX12 monoclonal antibody (M01), clone 3B9.Lane 1: STX12 transfected lysate(31.6 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IP |
| Clone | 3B9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | STX12 (NP_803173, 108 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERETAIRQLEADILDVNQIFKDLA |
| Marker | Early Endosomes Marker |
| Specificity | STX12 - syntaxin 12 (3B9) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | STX12 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Syntaxin 12 Antibody (H00023673-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunoprecipitation: Syntaxin 12 Antibody (3B9) [H00023673-M01] - Analysis of STX12 transfected lysate using anti-STX12 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STX12 MaxPab rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/Syntaxin-12-Antibody-3B9-Immunoprecipitation-H00023673-M01-img0001.jpg "Immunoprecipitation: Syntaxin 12 Antibody (3B9) [H00023673-M01] - Analysis of STX12 transfected lysate using anti-STX12 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STX12 MaxPab rabbit polyclonal antibody.")
![Sandwich ELISA: Syntaxin 12 Antibody (3B9) [H00023673-M01] - Detection limit for recombinant GST tagged STX12 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Syntaxin-12-Antibody-3B9-Sandwich-ELISA-H00023673-M01-img0002.jpg "Sandwich ELISA: Syntaxin 12 Antibody (3B9) [H00023673-M01] - Detection limit for recombinant GST tagged STX12 is 0.3 ng/ml as a capture antibody.")
