![Western Blot: ST3GAL3 Antibody [NBP2-13389] - Analysis in control (vector only transfected HEK293T lysate) and ST3GAL3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/ST3GAL3-Antibody-Western-Blot-NBP2-13389-img0004.jpg "Western Blot: ST3GAL3 Antibody [NBP2-13389] - Analysis in control (vector only transfected HEK293T lysate) and ST3GAL3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIF |
| Predicted Species | Mouse (90%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ST3GAL3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/E-Selectin_BBA16_Immunohistochemistry_6938.jpg)
![Immunocytochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/E-Selectin_BBA16_Immunocytochemistry_9821.jpg)
![Flow Cytometry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/bba16_human-e-selectin-cd62e-mab-clone-bbig-e4-flow-cytometry-25102021144214.jpg)
| Publication using NBP2-13389 | Applications | Species |
|---|---|---|
| Jia N, Barclay WS, Roberts K et al. Glycomic characterisation of respiratory tract tissues of ferrets: implications for its use in influenza virus infection studies. J Biol Chem. 2014-08-18 [PMID: 25135641] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ST3GAL3 |
![Immunohistochemistry-Paraffin: ST3GAL3 Antibody [NBP2-13389] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ST3GAL3-Antibody-Immunohistochemistry-Paraffin-NBP2-13389-img0003.jpg "Immunohistochemistry-Paraffin: ST3GAL3 Antibody [NBP2-13389] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Simple Western ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST6GAL1_AF5924_Simple_Western_16761.jpg)
![Western Blot ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST6GAL1_AF5924_Western_Blot_9445.jpg)
![Immunocytochemistry ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5924_human-st6gal1-affinity-purified-polyclonal-ab-immunocytochemistry-31102022135751.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")