| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 801-900 of Human SREBP1 Source: Wheat Germ (in vitro) Amino Acid Sequence: VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | SREBF1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 36.63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Research Areas for SREBP1 Partial Recombinant Protein (H00006720-Q01)Find related products by research area.
|
|
Metabolic Syndrome: Symptoms and associated disease states By Jamshed Arslan, Pharm. D., PhD. What is metabolic syndrome?It was 1988 when, after decades of research, Dr. GM Reaven of the Stanford University, CA, explained the relationship between four diseases:... Read full blog post. |
|
SREBP2 - regulating cholesterol homeostasis and lipid metabolism Sterol regulatory element-binding proteins (SREBP) are important transcription factors regulating the synthesis and uptake of lipids including cholesterol. This essential role in lipid metabolism makes investigations into the functions SREBPs im... Read full blog post. |
|
SREBP: Gatekeeper of Cholesterol Homeostasis SREBP1 (sterol-regulatory-element-binding protein 2) is a basic-helix-loop-helix-leucine zipper (bHLH-ZIP) transcription factor. It regulates sterol and cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g. ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SREBF1 |
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunohistochemistry LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDL_R_AF2255_Immunohistochemistry_7149.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDLR_AF2255_Western_Blot_23731.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2255_mouse-ldl-r-affinity-purified-polyclonal-ab-4120241049445.jpg)
![Western Blot SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD-1_AF7550_Western_Blot_12344.jpg)
![Knockout Validated SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD1_AF7550_Knockout_Validated_24050.jpg)
![Knockout Validated SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af7550_human-scd-1-affinity-purified-polyclonal-ab-20820241518560.png)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)