![Western Blot: Src Antibody (7G6M9) [NBP3-15675] - Western blot analysis of extracts of Jurkat cells, using Src antibody (NBP3-15675) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.](http://images.novusbio.com/fullsize/Src-Antibody-7G6M9-Western-Blot-NBP3-15675-img0004.jpg "Western Blot: Src Antibody (7G6M9) [NBP3-15675] - Western blot analysis of extracts of Jurkat cells, using Src antibody (NBP3-15675) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IP, KO |
| Clone | 7G6M9 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Src (P12931). MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTE |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | SRC |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 60 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Src Antibody (NBP3-15675)Find related products by research area.
|
|
Androgen Receptor: What Makes a Man? Steroid receptors (SRs) are a superfamily of ligand-dependent nuclear transcription factors that activate responsive genes response to hormone. Androgen receptors (ARs) are found in a wide variety of tissues, including reproductive organs, central ner... Read full blog post. |
|
The Heat is On: Heat Shock Proteins and the Link to Cancer Novus Biologicals offers an extensive antibody catalog targeting heat shock proteins (HSPs). A large protein group covering a number of families, the HSPs are functionally related by their dramatic upregulation in response to stress. Stress triggers m... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SRC |
![Western Blot: Src Antibody (7G6M9) [NBP3-15675] - Western blot analysis of extracts of various cell lines, using Src antibody (NBP3-15675) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/Src-Antibody-7G6M9-Western-Blot-NBP3-15675-img0003.jpg "Western Blot: Src Antibody (7G6M9) [NBP3-15675] - Western blot analysis of extracts of various cell lines, using Src antibody (NBP3-15675) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
![Knockout Validated: Src Antibody (7G6M9) [NBP3-15675] - Western blot analysis of extracts from normal (control) and Src knockout (KO) HeLa cells, using Src antibody (NBP3-15675) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.](http://images.novusbio.com/fullsize/Src-Antibody-7G6M9-Knockout-Validated-NBP3-15675-img0001.jpg "Knockout Validated: Src Antibody (7G6M9) [NBP3-15675] - Western blot analysis of extracts from normal (control) and Src knockout (KO) HeLa cells, using Src antibody (NBP3-15675) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.")
![Immunocytochemistry/Immunofluorescence: Src Antibody (7G6M9) [NBP3-15675] - Confocal imaging of A549 cells using [KO Validated] Src Rabbit mAb (at dilution of 1:100) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15675_rabbit-src-mab-7g6m9-immunocytochemistry-immunofluorescence-127202493010..jpg "Immunocytochemistry/Immunofluorescence: Src Antibody (7G6M9) [NBP3-15675] - Confocal imaging of A549 cells using [KO Validated] Src Rabbit mAb (at dilution of 1:100) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.")
![Immunocytochemistry/Immunofluorescence: Src Antibody (7G6M9) [NBP3-15675] - Confocal imaging of NIH/3T3 cells using [KO Validated] Src Rabbit mAb (at dilution of 1:100) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15675_rabbit-src-mab-7g6m9-immunocytochemistry-immunofluorescence-127202493116..jpg "Immunocytochemistry/Immunofluorescence: Src Antibody (7G6M9) [NBP3-15675] - Confocal imaging of NIH/3T3 cells using [KO Validated] Src Rabbit mAb (at dilution of 1:100) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Immunohistochemistry_6835.jpg)
![Knockout Validated FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Knockout_Validated_22783.jpg)
![Western Blot FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/af4467_human-mouse-rat-fak-affinity-purified-polyclonal-ab-western-blot-116202015471.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Western Blot GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Western_Blot_5355.jpg)
![Immunohistochemistry GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Immunohistochemistry_6809.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")