Home » SP140 » SP140 Proteins » SP140 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SP140 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SP140 Protein (NBP1-81275PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SP140 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SP140.

Source: E. coli

Amino Acid Sequence: SELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPKAGGGDAEDAPSLLPGGGVSCKLAIQIDEGESEEMPKLLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SP140
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81275.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SP140 Recombinant Protein Antigen

  • Lymphoid-restricted homolog of Sp100
  • lymphoid-specific SP100 homolog
  • LYSP100
  • LYSP100-A
  • LYSP100-B
  • MGC126440
  • Nuclear autoantigen Sp-140
  • nuclear body protein SP140
  • SP140 nuclear body protein
  • Speckled 140 kDa

Background

SP140 is a component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body. May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SP100 Antibody
NBP1-86060
Immunohistochemistry-Paraffin SP100 Antibody
Immunohistochemistry-Paraffin SP100 Antibody
Immunohistochemistry-Paraffin SP100 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, Micro, WB
PML Protein
Antibody - BSA Free
NB100-59787
Western Blot PML Protein Antibody - BSA Free
Immunohistochemistry PML Protein Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PML Protein Antibody - BSA Free
(1 Review)
(42 Publications)
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
HAI-1/HGFA
Inhibitor 1 Antibody ...
AF1048
Western Blot HAI-1/HGFA Inhibitor 1 Antibody [Unconjugated]
Immunohistochemistry HAI-1/HGFA Inhibitor 1 Antibody [Unconjugated]
Simple Western HAI-1/HGFA Inhibitor 1 Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
RAR alpha/NR1B1
Antibody (763)
NB200-322
Western Blot RAR alpha/NR1B1 Antibody (763)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
PRAM1 Antibody
NBP1-31075
Immunohistochemistry-Paraffin PRAM1 Antibody
Western Blot PRAM1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
IRF1 Antibody
[Unconjugated]
AF4715
Western Blot IRF1 Antibody [Unconjugated]
Western Blot IRF1 Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Mu
Applications: WB
IRF4 Antibody
AF5525
Immunohistochemistry IRF4 Antibody
Western Blot IRF4 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: IHC, WB
DAN/NBL1 Antibody
[Unconjugated]
AF755
DAN/NBL1 Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: Block, WB
Serpin
C1/Antithrombin-III A ...
AF1267
Serpin C1/Antithrombin-III Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: IP, Neut, WB
NM23-H1 Antibody
NBP1-80992
Immunohistochemistry-Paraffin NM23-H1 Antibody
Immunohistochemistry-Paraffin NM23-H1 Antibody
Immunohistochemistry-Paraffin NM23-H1 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DRIL1 Antibody
(1A11)
H00001820-M01
Western Blot DRIL1 Antibody (1A11)
Western Blot DRIL1 Antibody (1A11)
ELISA DRIL1 Antibody (1A11)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
PA28 Activator
beta Subunit/PSME2 An ...
NBP3-32868
Western Blot PA28 Activator beta Subunit/PSME2 Antibody (PSH0-10)
Immunohistochemistry PA28 Activator beta Subunit/PSME2 Antibody (PSH0-10)
Immunocytochemistry/ Immunofluorescence PA28 Activator beta Subunit/PSME2 Antibody (PSH0-10)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Galectin-4
Antibody [Unconjugate
AF2128
Immunohistochemistry Galectin-4 Antibody [Unconjugated]
(5 Publications)
Species: Mu
Applications: IHC, WB
Protein Kinase D2
Antibody (OTI5G1)
NBP2-02984
Western Blot Protein Kinase D2 Antibody (OTI5G1)
Flow Cytometry Protein Kinase D2 Antibody (OTI5G1)
Immunocytochemistry/ Immunofluorescence Protein Kinase D2 Antibody (OTI5G1)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IDH2 Antibody -
BSA Free
NBP2-22166
Western Blot IDH2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence IDH2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence IDH2 Antibody - BSA Free
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Isocitrate
Dehydrogenase 1/IDH1 ...
MAB7049
Knockout Validated Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]
Immunocytochemistry Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]
Western Blot Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]
(6 Publications)
Species: Hu
Applications: ICC, IHC, KO, Simple Western, WB
DNMT3A Antibody
(64B1446) - BSA Free
NB120-13888
Western Blot DNMT3A Antibody (64B1446) - BSA Free
Flow Cytometry DNMT3A Antibody (64B1446) - BSA Free
Flow Cytometry DNMT3A Antibody (64B1446) - BSA Free
(3 Reviews)
(124 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, CyTOF-ready, Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, KD, KO, WB
CALML3 Antibody
NBP2-33434
Immunohistochemistry-Paraffin CALML3 Antibody
Immunohistochemistry-Paraffin CALML3 Antibody
Immunohistochemistry-Paraffin CALML3 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB

Publications for SP140 Protein (NBP1-81275PEP) (0)

There are no publications for SP140 Protein (NBP1-81275PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP140 Protein (NBP1-81275PEP) (0)

There are no reviews for SP140 Protein (NBP1-81275PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SP140 Protein (NBP1-81275PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SP140 Products

Array NBP1-81275PEP

Blogs on SP140

There are no specific blogs for SP140, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: DNMT3A Antibody (64B1446) [NB120-13888] - NTERA-2 cells were treated with Zebularine as indicated for 24 hours. Cell lysates were prepared and separated on a 7.5% gel by SDS-PAGE. Protein was transferred to PVDF membrane and blocked in 5% non-fat milk. The membrane was probed with 2 ug/mL anti-Dnmt3a in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Note the decrease in Dnmt3a expression upon treatment with 500 uM Zebularine (arrowhead). Additional bands at 90 and 75 kDa can also be detected with this antibody and may represent alternative splice variants. Tubulin is shown as a loading control.
DNMT3A Antibody (64B1446) - BSA Free
NB120-13888
Western Blot: PML Protein Antibody [NB100-59787] - PML-RARa is a HIF-I+-transcriptional co-activator. HEK-293 cells transfected with stable mutants of HIF-1I+-or HIF-2I+-and increasing concentrations of PML-RARI+-. Image collected and cropped by Citeab from the following publication (HIF factors cooperate with PML-RAR +/- to promote acute promyelocytic leukemia progression and relapse. EMBO Mol Med (2014)) licensed under a CC-BY license.
PML Protein Antibody - BSA Free
NB100-59787

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SP140 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SP140