![Western Blot: SNF5 Antibody [NBP1-90014] - Analysis using Anti-SMARCB1 antibody NBP1-90014 (A) shows similar pattern to independent antibody NBP1-90013 (B).](http://images.novusbio.com/fullsize/SNF5-Antibody-Western-Blot-NBP1-90014-img0012.jpg "Western Blot: SNF5 Antibody [NBP1-90014] - Analysis using Anti-SMARCB1 antibody NBP1-90014 (A) shows similar pattern to independent antibody NBP1-90013 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SMARCB1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SNF5 Antibody (NBP1-90014)Find related products by research area.
|
|
You can't be without me - SNF5 The protein encoded by SNF5 is a component of the chromatin-remodeling protein complex responsible for relieving repressive chromatin structures by allowing the transcriptional machinery to access targets more effectively. SNF5 has been found to be a ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SMARCB1 |
![Immunocytochemistry/Immunofluorescence: SNF5 Antibody [NBP1-90014] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SNF5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90014-img0006.jpg "Immunocytochemistry/Immunofluorescence: SNF5 Antibody [NBP1-90014] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90014] - Staining of human tonsil shows nuclear positivity.](http://images.novusbio.com/fullsize/SNF5-Antibody-Immunohistochemistry-Paraffin-NBP1-90014-img0011.jpg "Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90014] - Staining of human tonsil shows nuclear positivity.")
![Western Blot: SNF5 Antibody [NBP1-90014] - Analysis in human cell line HEK 293.](http://images.novusbio.com/fullsize/SNF5-Antibody-Western-Blot-NBP1-90014-img0008.jpg "Western Blot: SNF5 Antibody [NBP1-90014] - Analysis in human cell line HEK 293.")
![Western Blot: SNF5 Antibody [NBP1-90014] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/SNF5-Antibody-Western-Blot-NBP1-90014-img0009.jpg "Western Blot: SNF5 Antibody [NBP1-90014] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")