![Western Blot: SMARCA5/SNF2H Antibody [NBP1-89692] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SMARCA5 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/SMARCA5-SNF2H-Antibody-Western-Blot-NBP1-89692-img0009.jpg "Western Blot: SMARCA5/SNF2H Antibody [NBP1-89692] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SMARCA5 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SMARCA5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89692 | Applications | Species |
|---|---|---|
| Polyakova O, Borman S, Grimley R et al. Identification of Novel Interacting Partners of Sirtuin6. PLoS One 2012-01-01 [PMID: 23240041] |
Secondary Antibodies |
Isotype Controls |
Research Areas for SMARCA5/SNF2H Antibody (NBP1-89692)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SMARCA5 |
![Immunocytochemistry/Immunofluorescence: SMARCA5/SNF2H Antibody [NBP1-89692] - Staining of human cell line A-431 shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SMARCA5-SNF2H-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89692-img0008.jpg "Immunocytochemistry/Immunofluorescence: SMARCA5/SNF2H Antibody [NBP1-89692] - Staining of human cell line A-431 shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SMARCA5/SNF2H Antibody [NBP1-89692] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.](http://images.novusbio.com/fullsize/SMARCA5-SNF2H-Antibody-Immunohistochemistry-Paraffin-NBP1-89692-img0001.jpg "Immunohistochemistry-Paraffin: SMARCA5/SNF2H Antibody [NBP1-89692] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.")
![Western Blot: SMARCA5/SNF2H Antibody [NBP1-89692] - Analysis in human cell line MOLT-4.](http://images.novusbio.com/fullsize/SMARCA5-SNF2H-Antibody-Western-Blot-NBP1-89692-img0006.jpg "Western Blot: SMARCA5/SNF2H Antibody [NBP1-89692] - Analysis in human cell line MOLT-4.")
![Western Blot: SMARCA5/SNF2H Antibody [NBP1-89692] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/SMARCA5-SNF2H-Antibody-Western-Blot-NBP1-89692-img0007.jpg "Western Blot: SMARCA5/SNF2H Antibody [NBP1-89692] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: SMARCA5/SNF2H Antibody [NBP1-89692] -Staining of human tonsil shows strong nuclear positivity in germinal and non-germinal center cells](http://images.novusbio.com/fullsize/antibody/nbp1-89692_rabbit-polyclonal-smarca5-snf2h-antibody-immunohistochemistry-paraffin-276202312526..jpg "Immunohistochemistry-Paraffin: SMARCA5/SNF2H Antibody [NBP1-89692] -Staining of human tonsil shows strong nuclear positivity in germinal and non-germinal center cells")
![Immunohistochemistry-Paraffin: SMARCA5/SNF2H Antibody [NBP1-89692] -Staining of human small intestine shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp1-89692_rabbit-polyclonal-smarca5-snf2h-antibody-immunohistochemistry-paraffin-2762023125316..jpg "Immunohistochemistry-Paraffin: SMARCA5/SNF2H Antibody [NBP1-89692] -Staining of human small intestine shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SMARCA5/SNF2H Antibody [NBP1-89692] -Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-89692_rabbit-polyclonal-smarca5-snf2h-antibody-immunohistochemistry-paraffin-2762023125421..jpg "Immunohistochemistry-Paraffin: SMARCA5/SNF2H Antibody [NBP1-89692] -Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")