![Western Blot: BAZ2A Antibody [NBP2-91988] - Analysis of extracts of various cell lines, using BAZ2A at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 180s.](http://images.novusbio.com/fullsize/BAZ2A-Antibody-Western-Blot-NBP2-91988-img0005.jpg "Western Blot: BAZ2A Antibody [NBP2-91988] - Analysis of extracts of various cell lines, using BAZ2A at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 180s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 97-295 of human BAZ2A (NP_038477.2). QYPSANPGSNLKDPPLLSQFSGGQYPLNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLELEEEQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BAZ2A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BAZ2A |
![Immunocytochemistry/Immunofluorescence: BAZ2A Antibody [NBP2-91988] - Analysis of U-2 OS cells using BAZ2A at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/BAZ2A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-91988-img0001.jpg "Immunocytochemistry/Immunofluorescence: BAZ2A Antibody [NBP2-91988] - Analysis of U-2 OS cells using BAZ2A at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: BAZ2A Antibody [NBP2-91988] - Mouse testis using BAZ2A antibody at dilution of 1:200 (40x lens).](http://images.novusbio.com/fullsize/BAZ2A-Antibody-Immunohistochemistry-Paraffin-NBP2-91988-img0004.jpg "Immunohistochemistry-Paraffin: BAZ2A Antibody [NBP2-91988] - Mouse testis using BAZ2A antibody at dilution of 1:200 (40x lens).")
![Immunohistochemistry-Paraffin: BAZ2A Antibody [NBP2-91988] - Human colon carcinoma using BAZ2A antibody at dilution of 1:200 (40x lens).](http://images.novusbio.com/fullsize/BAZ2A-Antibody-Immunohistochemistry-Paraffin-NBP2-91988-img0002.jpg "Immunohistochemistry-Paraffin: BAZ2A Antibody [NBP2-91988] - Human colon carcinoma using BAZ2A antibody at dilution of 1:200 (40x lens).")
![Immunohistochemistry-Paraffin: BAZ2A Antibody [NBP2-91988] - Human mammary cancer using BAZ2A antibody at dilution of 1:200 (40x lens).](http://images.novusbio.com/fullsize/BAZ2A-Antibody-Immunohistochemistry-Paraffin-NBP2-91988-img0003.jpg "Immunohistochemistry-Paraffin: BAZ2A Antibody [NBP2-91988] - Human mammary cancer using BAZ2A antibody at dilution of 1:200 (40x lens).")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")