Novus Biologicals products are now on bio-techne.com

Recombinant Human Smad1 GST (N-Term) Protein

Name: Recombinant Human Smad1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00004086-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Smad1 GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-110 of Human Smad1 Source: Wheat Germ (in vitro) Amino Acid Sequence: MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCE
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	SMAD1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Smad1 GST (N-Term) Protein

BSP1
BSP-1
hSMAD1
JV4-1SMAD, mothers against DPP homolog 1 (Drosophila)
MAD homolog 1
MADH1JV41
MADR1MAD, mothers against decapentaplegic homolog 1 (Drosophila)
Mad-related protein 1
mothers against decapentaplegic homolog 1
Mothers against DPP homolog 1
SMAD family member 1SMAD 1
SMAD, mothers against DPP homolog 1
Smad1
TGF-beta signaling protein 1
transforming growth factor-beta signaling protein 1

Background

SMAD1 - SMAD, mothers against DPP homolog 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BMP-2
[Unconjugated]

355-BM

(187 Publications)

Species: Hu, Mu, Rt

Applications: BA

BMP-4
[Unconjugated]

314-BP

(505 Publications)

Species: Hu

Applications: BA, BA

Smad2/3 Antibody
[Unconjugated]

AF3797

Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]

Immunocytochemistry Smad2/3 Antibody [Unconjugated]

(1 Review)

(24 Publications)

Species: Hu, Mu

Applications: ChIP, ICC, IHC, Simple Western, WB

Smad4 Antibody
[Unconjugated]

AF2097

Western Blot Smad4 Antibody [Unconjugated]

Immunocytochemistry Smad4 Antibody [Unconjugated]

(9 Publications)

Species: Hu

Applications: ChIP, ICC, WB

Smad5 [p Ser463, p
Ser465] Antibody (SY0 ...

NBP2-67394

Immunohistochemistry-Paraffin Smad5 [p Ser463, p Ser465] Antibody (SY09-03)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

BMP-2
[Unconjugated]

355-BM

(187 Publications)

Species: Hu, Mu, Rt

Applications: BA

Smad3 Antibody

NB100-56479

Immunohistochemistry-Paraffin Smad3 Antibody

(5 Reviews)

(8 Publications)

Species: Bv, Ca, Hu, Mu, Po, Pm, Rt

Applications: ICC/IF, IHC, IHC-P, WB

ERK1 Antibody
(1E5) - BSA Free

NBP2-22203

Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free

Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free

(1 Publication)

Species: Hu, Pm, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

Smad9 Antibody

AF7215

Species: Hu, Mu

Applications: ICC, IHC

BMP-7
[Unconjugated]

354-BP

(94 Publications)

Species: Hu

Applications: BA

SMAD6 Antibody

NB100-56440

(2 Reviews)

(10 Publications)

Species: Hu, Pm, Mu, Pm, Rt, Sh

Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

RUNX2/CBFA1
Antibody (232902) [Un ...

MAB2006

(1 Review)

(28 Publications)

Species: Hu

Applications: ICC

SLPI [HRP]

DPI00

(36 Publications)

Species: Hu

Applications: ELISA

TGF-beta RI/ALK-5
Antibody [Unconjugate ...

AF3025

Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]

(16 Publications)

Species: Hu

Applications: ELISA, ICC, WB

ALK-1 Antibody
[Unconjugated]

AF370

(1 Review)

(18 Publications)

Species: Hu

Applications: IP, WB

TGF-beta 1
[Unconjugated]

7754-BH/CF

(53 Publications)

Species: Hu

Applications: BA

BMP-6
[Unconjugated]

507-BP

(72 Publications)

Species: Hu

Applications: BA

Smad7 Antibody
(293039) [Unconjugate

MAB2029

Immunohistochemistry Smad7 Antibody (293039) [Unconjugated]

(1 Review)

(59 Publications)

Species: Hu, Mu, Rt

Applications: IHC, Simple Western, WB

Noggin
[Unconjugated]

6057-NG

(199 Publications)

Species: Hu

Applications: BA

Publications for Smad1 Partial Recombinant Protein (H00004086-Q01) (0)

There are no publications for Smad1 Partial Recombinant Protein (H00004086-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smad1 Partial Recombinant Protein (H00004086-Q01) (0)

There are no reviews for Smad1 Partial Recombinant Protein (H00004086-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Smad1 Partial Recombinant Protein (H00004086-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Smad1 Products

Research Areas for Smad1 Partial Recombinant Protein (H00004086-Q01)

Find related products by research area.

Blogs on Smad1.

Check out the latest blog posts on Smad1.

Alpha-smooth muscle actin and the modulation of endothelial and epithelial cell biology
Actin is essential for a wide range of cell functions, ranging from cell division and chromatin remodeling to vesicle trafficking and maintenance of cellular structure. In fact, mislocalization of actin to cell junctions during development leads t... Read full blog post.

Nanog is a Master Controller of ES cell Pluripotency
Nanog, a homeodomain (HD) transcription factor, plays a critical role in the maintenance of embryonic stem (ES) cell self-renewal. Transcription regulator involved in inner cell mass and ES cell proliferation and self-renewal. Imposes pluripotency on ... Read full blog post.

Transforming Growth Factor beta Signaling in Stem Cells
Transforming growth factor beta (TGF beta) signaling along with its family members have been implicated in development and maintenance of various organs. Stem cells are important contributors to this process and are characterized by their ability to s... Read full blog post.

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human Smad1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

SMAD1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human Smad1 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human Smad1 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human Smad1 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Smad1 Partial Recombinant Protein (H00004086-Q01) (0)

Reviews for Smad1 Partial Recombinant Protein (H00004086-Q01) (0)

Product General Protocols

Video Protocols

FAQs for Smad1 Partial Recombinant Protein (H00004086-Q01) (0)

Additional Smad1 Products

Research Areas for Smad1 Partial Recombinant Protein (H00004086-Q01)

Blogs on Smad1.

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics