![Western Blot: SLC7A9 Antibody [NBP2-93638] - Analysis of extracts of various cell lines, using SLC7A9 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/SLC7A9-Antibody-Western-Blot-NBP2-93638-img0004.jpg "Western Blot: SLC7A9 Antibody [NBP2-93638] - Analysis of extracts of various cell lines, using SLC7A9 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC7A9 (NP_055085.1). MGDTGLRKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFVSPKSVLSNTEAVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC7A9 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 53 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
![Western Blot NTAL Antibody [Unconjugated]](https://images.novusbio.com/images2/NTAL_AF4066_Western_Blot_5396.jpg)
![Intracellular Staining by Flow Cytometry NTAL Antibody [Unconjugated]](https://images.novusbio.com/images2/NTAL_AF4066_Flow_Cytometry_8223.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC7A9 Antibody (NBP2-93638)Find related products by research area.
|
|
The effects of ethanol consumption on glutamate production and xCT xCT is a sodium independent glutamate transporter that regulates the exchange of extracellular l-cystine and intracellular l-glutamate across the plasma membrane. This process is critical to glutathione production and protection from subsequent ox... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC7A9 |
![Immunohistochemistry: SLC7A9 Antibody [NBP2-93638] - Analysis of rat kidney using SLC7A9 at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/SLC7A9-Antibody-Immunohistochemistry-NBP2-93638-img0003.jpg "Immunohistochemistry: SLC7A9 Antibody [NBP2-93638] - Analysis of rat kidney using SLC7A9 at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry: SLC7A9 Antibody [NBP2-93638] - Analysis of human kidney cancer using SLC7A9 at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/SLC7A9-Antibody-Immunohistochemistry-NBP2-93638-img0001.jpg "Immunohistochemistry: SLC7A9 Antibody [NBP2-93638] - Analysis of human kidney cancer using SLC7A9 at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry: SLC7A9 Antibody [NBP2-93638] - Analysis of human kidney cancer using SLC7A9 at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/SLC7A9-Antibody-Immunohistochemistry-NBP2-93638-img0002.jpg "Immunohistochemistry: SLC7A9 Antibody [NBP2-93638] - Analysis of human kidney cancer using SLC7A9 at dilution of 1:100. Blue: DAPI for nuclear staining.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE Lymphotoxin-alpha/TNF-beta [Unconjugated]](https://images.novusbio.com/images2/Lymphotoxin-alpha_211-TBB_CF_695.jpg)
![Bioactivity Lymphotoxin-alpha/TNF-beta [Unconjugated]](https://images.novusbio.com/images2/Lymphotoxin-alpha_211-TBB_CF_697.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")