![Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize/SLC6A2-NET-Noradrenaline-transporter-Antibody-Western-Blot-NBP1-60120-img0008.jpg "Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to SLC6A2(solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2) The peptide sequence was selected from the middle region of SLC6A2.
Peptide sequence STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC6A2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC6A2/NET/Noradrenaline transporter Antibody (NBP1-60120)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Human Adult Placenta](http://images.novusbio.com/fullsize/SLC6A2-NET-Noradrenaline-transporter-Antibody-Western-Blot-NBP1-60120-img0005.jpg "Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Human Adult Placenta")
![Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Tissue:Human Fetal Lung.](http://images.novusbio.com/fullsize/SLC6A2-NET-Noradrenaline-transporter-Antibody-Western-Blot-NBP1-60120-img0006.jpg "Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Tissue:Human Fetal Lung.")
![Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12](http://images.novusbio.com/fullsize/SLC6A2-NET-Noradrenaline-transporter-Antibody-Western-Blot-NBP1-60120-img0007.jpg "Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12")
![Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.](http://images.novusbio.com/fullsize/SLC6A2-NET-Noradrenaline-transporter-Antibody-Western-Blot-NBP1-60120-img0003.jpg "Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.")
![Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Human Fetal Heart.](http://images.novusbio.com/fullsize/SLC6A2-NET-Noradrenaline-transporter-Antibody-Tissue-Culture-Substratum-NBP1-60120-img0004.jpg "Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP1-60120] - Human Fetal Heart.")
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")