![Western Blot: SLC35F2 Antibody [NBP1-59890] - Transfected 293T tissue lysate at a concentration of 2.5ug/ml.](http://images.novusbio.com/fullsize/SLC35F2-Antibody-Western-Blot-NBP1-59890-img0001.jpg "Western Blot: SLC35F2 Antibody [NBP1-59890] - Transfected 293T tissue lysate at a concentration of 2.5ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to SLC35F2(solute carrier family 35, member F2) The peptide sequence was selected from the N terminal of SLC35F2. Peptide sequence MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC35F2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
| Publication using NBP1-59890 | Applications | Species |
|---|---|---|
| Chandrasekaran AP, Kaushal K, Park CH et al. USP32 confers cancer cell resistance to YM155 via promoting ER-associated degradation of solute carrier protein SLC35F2 Theranostics 2021-09-27 [PMID: 34815782] (Immunohistochemistry, Western Blot, Immunohistochemistry-Paraffin) | Immunohistochemistry, Western Blot, Immunohistochemistry-Paraffin |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SLC35F2 Antibody [NBP1-59890] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://images.novusbio.com/fullsize/SLC35F2-Antibody-Immunohistochemistry-Paraffin-NBP1-59890-img0002.jpg "Immunohistochemistry-Paraffin: SLC35F2 Antibody [NBP1-59890] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.")
![Immunocytochemistry ErbB4/Her4 Antibody (182803) [Unconjugated]](https://images.novusbio.com/images2/ErbB4_MAB1131_Immunocytochemistry__Immunofluorescence_21145.jpg)
![Immunohistochemistry ErbB4/Her4 Antibody (182803) [Unconjugated]](https://images.novusbio.com/images2/ErbB4_MAB1131_Immunohistochemistry_12968.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")