![Western Blot: OCIAD1 Antibody [H00054940-B01P] - Analysis of OCIAD1 expression in human pancreas.](http://images.novusbio.com/fullsize/OCIAD1-Antibody-Western-Blot-H00054940-B01P-img0003.jpg "Western Blot: OCIAD1 Antibody [H00054940-B01P] - Analysis of OCIAD1 expression in human pancreas.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | OCIAD1 (AAH03409, 1 a.a. - 245 a.a.) full-length human protein. MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE |
| Specificity | OCIAD1 - OCIA domain containing 1, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | OCIAD1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for OCIAD1 Antibody (H00054940-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: OCIAD1 Antibody [H00054940-B01P] - Analysis of OCIAD1 expression in transfected 293T cell line by OCIAD1 polyclonal antibody. Lane 1: OCIAD1 transfected lysate(27.06 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/OCIAD1-Antibody-Western-Blot-H00054940-B01P-img0004.jpg "Western Blot: OCIAD1 Antibody [H00054940-B01P] - Analysis of OCIAD1 expression in transfected 293T cell line by OCIAD1 polyclonal antibody. Lane 1: OCIAD1 transfected lysate(27.06 KDa). Lane 2: Non-transfected lysate.")
![N/A PLGF [HRP]](https://images.novusbio.com/images2/PlGF_DPG00_ELISA_158.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_788.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_789.jpg)
![Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Flow_Cytometry_17077.jpg)
![Immunocytochemistry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Immunocytochemistry__Immunofluorescence_17398.jpg)
![Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Flow_Cytometry_23861.jpg)
![Flow Cytometry Integrin alpha E/CD103 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1990_mouse-integrin-alpha-e-cd103-affinity-purified-polyclonal-ab-flow-cytometry-2052024123524..jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")