![Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SLC35D3-Antibody-Immunohistochemistry-Paraffin-NBP1-81867-img0009.jpg "Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKQSNYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYLEVWRLVRGTRYM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC35D3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![INSRR/IR-related receptor Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "INSRR/IR-related receptor Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC35D3 Antibody (NBP1-81867)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC35D3 |
![Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC35D3-Antibody-Immunohistochemistry-Paraffin-NBP1-81867-img0005.jpg "Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human upper gastrointestinal shows moderate to strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC35D3-Antibody-Immunohistochemistry-Paraffin-NBP1-81867-img0006.jpg "Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human upper gastrointestinal shows moderate to strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human lung shows moderate to strong granular cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/SLC35D3-Antibody-Immunohistochemistry-Paraffin-NBP1-81867-img0007.jpg "Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human lung shows moderate to strong granular cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human salivary gland shows moderate to strong granular cytoplasmic positivity in ductal cells.](http://images.novusbio.com/fullsize/SLC35D3-Antibody-Immunohistochemistry-Paraffin-NBP1-81867-img0008.jpg "Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human salivary gland shows moderate to strong granular cytoplasmic positivity in ductal cells.")
![Western Blot NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-4120241239327.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412401270.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412403531.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")