SLC22A2/OCT2 Antibody (CL0628) [PE] Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR |
Isotype |
IgG1 |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
SLC22A2 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%).
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
PBS |
Preservative |
0.05% Sodium Azide |
Purity |
Protein A purified |
Alternate Names for SLC22A2/OCT2 Antibody (CL0628) [PE]
Background
SLC22A2 - solute carrier family 22 (organic cation transporter), member 2
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, PA, WB
Species: Hu
Applications: IHC
Publications for SLC22A2/OCT2 Antibody (NBP2-52941PE) (0)
There are no publications for SLC22A2/OCT2 Antibody (NBP2-52941PE).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC22A2/OCT2 Antibody (NBP2-52941PE) (0)
There are no reviews for SLC22A2/OCT2 Antibody (NBP2-52941PE).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for SLC22A2/OCT2 Antibody (NBP2-52941PE) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SLC22A2/OCT2 Products
Blogs on SLC22A2/OCT2