![Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody (CL0628) [NBP2-52941] - Staining in human kidney and pancreas tissues. Corresponding SLC22A2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC22A2-OCT2-Antibody-CL0628-Immunohistochemistry-Paraffin-NBP2-52941-img0010.jpg "Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody (CL0628) [NBP2-52941] - Staining in human kidney and pancreas tissues. Corresponding SLC22A2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clone | CL0628 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR |
| Epitope | KNAEAMRIIKHIAKK |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLC22A2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC22A2 |
![Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody (CL0628) [NBP2-52941] - Staining of human kidney show strong positivity in apical membrane in cells in tubules.](http://images.novusbio.com/fullsize/SLC22A2-OCT2-Antibody-CL0628-Immunohistochemistry-Paraffin-NBP2-52941-img0007.jpg "Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody (CL0628) [NBP2-52941] - Staining of human kidney show strong positivity in apical membrane in cells in tubules.")
![Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody (CL0628) [NBP2-52941] - Staining of human cerebral cortex shows strong membranous positivity in astrocytes.](http://images.novusbio.com/fullsize/SLC22A2-OCT2-Antibody-CL0628-Immunohistochemistry-Paraffin-NBP2-52941-img0008.jpg "Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody (CL0628) [NBP2-52941] - Staining of human cerebral cortex shows strong membranous positivity in astrocytes.")
![Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody (CL0628) [NBP2-52941] - Staining of human pancreas shows no positivity in either exocrine or endocrine glandular cells as expected.](http://images.novusbio.com/fullsize/SLC22A2-OCT2-Antibody-CL0628-Immunohistochemistry-Paraffin-NBP2-52941-img0009.jpg "Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody (CL0628) [NBP2-52941] - Staining of human pancreas shows no positivity in either exocrine or endocrine glandular cells as expected.")
![Immunocytochemistry Plexin A2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A2_AF5486_Immunocytochemistry_11380.jpg)
![Immunocytochemistry Plexin A2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A2_AF5486_Immunocytochemistry_11381.jpg)
![Simple Western Plexin A2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A2_AF5486_Simple_Western_17021.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")