Immunocytochemistry/ Immunofluorescence: SLC15A4 Antibody [NBP1-87279] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human colon shows moderate to strong positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human endometrium shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human lymph node shows moderate to strong positivity in lymphoid cells.
Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human testis shows moderate to strong positivity.
This antibody was developed against Recombinant Protein corresponding to amino acids: TKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC15A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in scientific literature (PMID: 31312142). Rat (85%).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for SLC15A4 Antibody
Peptide transporter 4
Peptide/histidine transporter 1
PHT1hPHT1
PTR4peptide-histidine transporter 4
solute carrier family 15 member 4
solute carrier family 15, member 4
Background
Proton oligopeptide cotransporter. Transports free histidine and certain di- and tripeptides
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for SLC15A4 Antibody (NBP1-87279). (Showing 1 - 1 of 1 FAQ).
I am interested in an antibody against Slc15a4. I would like to use it for mouse and human tissues for WB and IHC experiments. I have seen that the antibody NBP1-87279 targeting the human protein has been used to detect also rat and mouse protein in WB. Do you know whether cross reactivity also exists for IHC with mouse samples? And are there any specific references, where this antibody has been used?
NBP1-87279 has been validated for mouse and rat cross reactivity using Western blot and we do not currently have any testing data for IHC in these 2 species.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SLC15A4 Antibody and receive a gift card or discount.