![Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining in human liver and skeletal muscle tissues . Corresponding SHMT2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SHMT2-Antibody-Immunohistochemistry-Paraffin-NBP1-80754-img0020.jpg "Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining in human liver and skeletal muscle tissues . Corresponding SHMT2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SHMT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC reported in scientific literature (PMID: 25855294). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human duodenum, liver, lymph node and skeletal muscle using Anti-SHMT2 antibody NBP1-80754 (A) shows similar protein distribution across tissues to independent antibody NBP1-80755 (B).](http://images.novusbio.com/fullsize/SHMT2-Antibody-Immunohistochemistry-Paraffin-NBP1-80754-img0027.jpg "Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human duodenum, liver, lymph node and skeletal muscle using Anti-SHMT2 antibody NBP1-80754 (A) shows similar protein distribution across tissues to independent antibody NBP1-80755 (B).")
![Western Blot: SHMT2 Antibody [NBP1-80754] - Analysis using Anti-SHMT2 antibody NBP1-80754 (A) shows similar pattern to independent antibody NBP1-80755 (B).](http://images.novusbio.com/fullsize/SHMT2-Antibody-Western-Blot-NBP1-80754-img0022.jpg "Western Blot: SHMT2 Antibody [NBP1-80754] - Analysis using Anti-SHMT2 antibody NBP1-80754 (A) shows similar pattern to independent antibody NBP1-80755 (B).")
![Immunocytochemistry/Immunofluorescence: SHMT2 Antibody [NBP1-80754] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SHMT2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80754-img0009.jpg "Immunocytochemistry/Immunofluorescence: SHMT2 Antibody [NBP1-80754] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SHMT2-Antibody-Immunohistochemistry-Paraffin-NBP1-80754-img0028.jpg "Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.")
![Western Blot: SHMT2 Antibody [NBP1-80754] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/SHMT2-Antibody-Western-Blot-NBP1-80754-img0007.jpg "Western Blot: SHMT2 Antibody [NBP1-80754] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Western Blot: SHMT2 Antibody [NBP1-80754] - Analysis in human cell line RH-30.](http://images.novusbio.com/fullsize/SHMT2-Antibody-Western-Blot-NBP1-80754-img0010.jpg "Western Blot: SHMT2 Antibody [NBP1-80754] - Analysis in human cell line RH-30.")
![Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/SHMT2-Antibody-Immunohistochemistry-Paraffin-NBP1-80754-img0016.jpg "Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human lymph node shows moderate granular cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/SHMT2-Antibody-Immunohistochemistry-Paraffin-NBP1-80754-img0017.jpg "Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human lymph node shows moderate granular cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SHMT2-Antibody-Immunohistochemistry-Paraffin-NBP1-80754-img0018.jpg "Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80754] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]](https://images.novusbio.com/images2/PTHLH_MAB6734_Immunohistochemistry_10816.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")