![Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Analysis in human placenta and skeletal muscle tissues. Corresponding GLDC RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GLDC-Antibody-Immunohistochemistry-Paraffin-NBP1-83374-img0015.jpg "Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Analysis in human placenta and skeletal muscle tissues. Corresponding GLDC RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPENK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GLDC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC reported in scientific literature (PMID: 25855294). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
![Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/16253.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_21503.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_22402.jpg)
| Publication using NBP1-83374 | Applications | Species |
|---|---|---|
| Kim D, Fiske BP, Birsoy K et al. SHMT2 drives glioma cell survival in ischaemia but imposes a dependence on glycine clearance. Nature 2015-04-16 [PMID: 25855294] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for GLDC Antibody (NBP1-83374)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GLDC |
![Western Blot: GLDC Antibody [NBP1-83374] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-GLDC antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize/GLDC-Antibody-Western-Blot-NBP1-83374-img0013.jpg "Western Blot: GLDC Antibody [NBP1-83374] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-GLDC antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.")
![Western Blot: GLDC Antibody [NBP1-83374] - Western blot analysis in human cell lines Caco-2 and HeLa. Corresponding GLDC RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/GLDC-Antibody-Western-Blot-NBP1-83374-img0014.jpg "Western Blot: GLDC Antibody [NBP1-83374] - Western blot analysis in human cell lines Caco-2 and HeLa. Corresponding GLDC RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
![Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/GLDC-Antibody-Immunohistochemistry-Paraffin-NBP1-83374-img0018.jpg "Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot: GLDC Antibody [NBP1-83374] - Western blot analysis in mouse liver tissue and rat liver tissue.](http://images.novusbio.com/fullsize/GLDC-Antibody-Western-Blot-NBP1-83374-img0012.jpg "Western Blot: GLDC Antibody [NBP1-83374] - Western blot analysis in mouse liver tissue and rat liver tissue.")
![Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/GLDC-Antibody-Immunohistochemistry-Paraffin-NBP1-83374-img0009.jpg "Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human kidney shows moderate granular positivity in cytoplasm in cells in tubules.](http://images.novusbio.com/fullsize/GLDC-Antibody-Immunohistochemistry-Paraffin-NBP1-83374-img0016.jpg "Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human kidney shows moderate granular positivity in cytoplasm in cells in tubules.")
![Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human liver shows strong granular positivity in cytoplasm in hepatocytes.](http://images.novusbio.com/fullsize/GLDC-Antibody-Immunohistochemistry-Paraffin-NBP1-83374-img0017.jpg "Immunohistochemistry-Paraffin: GLDC Antibody [NBP1-83374] - Staining of human liver shows strong granular positivity in cytoplasm in hepatocytes.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")