![Western Blot: SF4 Antibody [NBP1-88000] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize/SF4-Antibody-Western-Blot-NBP1-88000-img0010.jpg "Western Blot: SF4 Antibody [NBP1-88000] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SUGP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SUGP1 |
![Immunocytochemistry/Immunofluorescence: SF4 Antibody [NBP1-88000] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/SF4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88000-img0008.jpg "Immunocytochemistry/Immunofluorescence: SF4 Antibody [NBP1-88000] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize/SF4-Antibody-Immunohistochemistry-Paraffin-NBP1-88000-img0014.jpg "Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.")
![Western Blot: SF4 Antibody [NBP1-88000] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/SF4-Antibody-Western-Blot-NBP1-88000-img0005.jpg "Western Blot: SF4 Antibody [NBP1-88000] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Western Blot: SF4 Antibody [NBP1-88000] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/SF4-Antibody-Western-Blot-NBP1-88000-img0007.jpg "Western Blot: SF4 Antibody [NBP1-88000] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.](http://images.novusbio.com/fullsize/SF4-Antibody-Immunohistochemistry-Paraffin-NBP1-88000-img0006.jpg "Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.")
![Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Analysis in human testis and liver tissues using NBP1-88000 antibody. Corresponding SUGP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SF4-Antibody-Immunohistochemistry-Paraffin-NBP1-88000-img0011.jpg "Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Analysis in human testis and liver tissues using NBP1-88000 antibody. Corresponding SUGP1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.](http://images.novusbio.com/fullsize/SF4-Antibody-Immunohistochemistry-Paraffin-NBP1-88000-img0012.jpg "Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.")
![Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/SF4-Antibody-Immunohistochemistry-Paraffin-NBP1-88000-img0013.jpg "Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts and leydig cells.](http://images.novusbio.com/fullsize/SF4-Antibody-Immunohistochemistry-Paraffin-NBP1-88000-img0015.jpg "Immunohistochemistry-Paraffin: SF4 Antibody [NBP1-88000] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts and leydig cells.")
![N/A RBP4/Retinol-Binding Protein 4 [HRP]](https://images.novusbio.com/images2/RBP4_DRB400_ELISA_169.jpg)
![N/A RBP4/Retinol-Binding Protein 4 [HRP]](https://images.novusbio.com/images2/DATA_RBP4_DRB400_ELISA_804.jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]](https://images.novusbio.com/images2/Uteroglobin_MAB4218_Immunohistochemistry_7019.jpg)
![Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]](https://images.novusbio.com/images2/Uteroglobin_MAB4218_Immunohistochemistry_9991.jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")